Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.00064 1.1 11.1 1.0 14 40 26 49 18 52 0.87

2 10 0.035 60 5.6 0.5 17 39 57 76 49 83 0.86

3 10 0.078 1.3e+02 4.5 1.2 18 38 86 103 81 103 0.84

4 10 0.02 34 6.3 4.9 2 28 99 124 98 136 0.87

5 10 0.00057 0.98 11.3 3.3 14 40 138 164 125 170 0.74

6 10 0.076 1.3e+02 4.5 2.6 16 39 168 188 161 192 0.82

7 10 5.6e-05 0.096 14.5 2.5 9 41 190 218 186 225 0.84

8 10 0.022 38 6.2 1.6 15 28 223 236 217 247 0.80

9 10 0.0072 12 7.8 0.9 17 39 253 272 239 282 0.78

10 10 0.022 38 6.2 2.0 18 41 282 302 273 303 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.00064	1.1	11.1	1.0	14	40	26	49	18	52	0.87
2	10	0.035	60	5.6	0.5	17	39	57	76	49	83	0.86
3	10	0.078	1.3e+02	4.5	1.2	18	38	86	103	81	103	0.84
4	10	0.02	34	6.3	4.9	2	28	99	124	98	136	0.87
5	10	0.00057	0.98	11.3	3.3	14	40	138	164	125	170	0.74
6	10	0.076	1.3e+02	4.5	2.6	16	39	168	188	161	192	0.82
7	10	5.6e-05	0.096	14.5	2.5	9	41	190	218	186	225	0.84
8	10	0.022	38	6.2	1.6	15	28	223	236	217	247	0.80
9	10	0.0072	12	7.8	0.9	17	39	253	272	239	282	0.78
10	10	0.022	38	6.2	2.0	18	41	282	302	273	303	0.89

Coding Sequence: ATGGGGGACATTTCTAACTATTTGGACAGTTCATCCACCACTTCTGTCCAATTTACAGTGGAAAAAAAAGACAGCAAAAAATCTCATAAGTGTGAAGtatgtgagaagagctttacccaggcatctaacttaaagaaacatctttggattcatgagggcaagaagccataTACATGTGAAGTTTGTGCAAAGAACTTCGCCTATAAATCacatttaagggaacatcttttgattcatggtggcaagaaaccatataaatgcgAAATTTGTAGAAAGAGCTTTACTTTGTCATCtactttgaagaaacattttttgattcatgaggacAAGGAGttacataagtgtgaagtttgtggaaagtgCTTTACCCGATTATGCTATTTtaggacacatcttttgattcacaagGGAAAGAAGCCCCATGAGTGTGAGATATGTGGAAAAAACTTTACCCAGGCTTCCAATTTAAGagaacatcttttaattcatcagagaaagaagccacataaatgtgaagtttgtgcgAAGACCTTCACCTATAAATCacatttaagggaacatcttttgattcatgaggacaAAAAACCatataagtgtgaaatttgtagGAAAAGCTTTAGGCAGACATCTAATTTGAAGAAGCATCTTGTGACTCATCAGGACAAAAAGCCACATAAGtgcaaaatttgtggaaagagctttaccagATTATTCTATTTcaggacacatcttttgattcatgagggaaaGAAGCCCCATGAGTGTGAGATATGTGGAAAAAACTTTACCCAGGCATTCAATTTAAGagaacatcttttaattcatgagggtaagaagccgcataattgtgaaatttgtggaaaaagctttacccaaatatctcatttaaagaaacatctttcaACTCATTAG
Protein Sequence: MGDISNYLDSSSTTSVQFTVEKKDSKKSHKCEVCEKSFTQASNLKKHLWIHEGKKPYTCEVCAKNFAYKSHLREHLLIHGGKKPYKCEICRKSFTLSSTLKKHFLIHEDKELHKCEVCGKCFTRLCYFRTHLLIHKGKKPHECEICGKNFTQASNLREHLLIHQRKKPHKCEVCAKTFTYKSHLREHLLIHEDKKPYKCEICRKSFRQTSNLKKHLVTHQDKKPHKCKICGKSFTRLFYFRTHLLIHEGKKPHECEICGKNFTQAFNLREHLLIHEGKKPHNCEICGKSFTQISHLKKHLSTH

Sequence clustering based on sequence similarity using MMseqs2