Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.17 1.6e+02 4.1 2.1 17 38 49 72 41 76 0.76

2 9 5.7e-07 0.00053 21.6 1.9 6 43 67 100 62 101 0.87

3 9 0.37 3.5e+02 3.0 0.5 18 39 107 130 102 134 0.81

4 9 0.06 56 5.5 0.3 18 40 135 154 132 163 0.80

5 9 0.017 16 7.3 5.1 10 42 158 187 151 189 0.75

6 9 0.0051 4.8 8.9 1.9 13 29 190 206 182 216 0.77

7 9 0.0058 5.4 8.8 0.8 13 29 217 233 210 247 0.74

8 9 0.0012 1.1 10.9 1.3 11 32 243 263 239 272 0.77

9 9 0.007 6.5 8.5 0.8 17 41 277 298 266 299 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.17	1.6e+02	4.1	2.1	17	38	49	72	41	76	0.76
2	9	5.7e-07	0.00053	21.6	1.9	6	43	67	100	62	101	0.87
3	9	0.37	3.5e+02	3.0	0.5	18	39	107	130	102	134	0.81
4	9	0.06	56	5.5	0.3	18	40	135	154	132	163	0.80
5	9	0.017	16	7.3	5.1	10	42	158	187	151	189	0.75
6	9	0.0051	4.8	8.9	1.9	13	29	190	206	182	216	0.77
7	9	0.0058	5.4	8.8	0.8	13	29	217	233	210	247	0.74
8	9	0.0012	1.1	10.9	1.3	11	32	243	263	239	272	0.77
9	9	0.007	6.5	8.5	0.8	17	41	277	298	266	299	0.84

Coding Sequence: ATGTATTGGAAGAAAACTTCATTATCACCGATTAGATGCAATCCATATAATGAGGTCCGTAGTTCTGAATCTAATGTTTGTGGTGTTACTTCGACAACTAATGTGGGACATACCGGCGATAGCAATTGGAACGACCTGAAGGAACACCAGTGTACAGTGTGCAAAAAGCAGTTTAAAAGTAAATATCAAGTAAATGCCCACATATTACGAGTACATCAAAAGAGTAATATACAGTGTGGTTATTGTTCAAAAACTTTTGCCGGCAAGAATGGTCTAAAGATGCATATAAGAAGTCAACATACGGACGATTTACCTTACAAGTGCAAAACATGTCAAAAACGATTTATAAGGCAAGATTTCTTAAATACACACATTAAAGTACAACACTTAGGGATAAGATACTATTGCGAGAAATGTGATAAGCAGTTCAAAGCAGATGTTACTTTGAGAAATCATATGCGCTTACATGAACCAAGTAGTGCACACAAGAaatatgtttgtaaaatttgctCAAAATCATTGGCTTCTAAAGCTGGGCTACATCTACATATGACTAGCTTGCACGGAGAAGAGAGCAAAGTTATATGCGACTTCTGTGGGAAAAAGTATAGAAAAGATCGCCTCAATGTCCATATTCGCAGTCACACTGGCGAAAAGCCTGTAAAATGTCCGCATTGTGAGAAAACCTTTACGGAGAGAAGAATTCTTACAGTGCATTTACGAGTCCACACAAAAGAAAAGCCATATACGTGTAAGATCTGTAATAAAGCTTTTAGCCAAGGTGGAACACTAAAAATTCATATGCGATTCCACACGGGTGAACGTCCTTATGTATGTAAACTATGTGATAAGGGCTTTGCGTCGAGCACCTCATTGAGATCACATATGAAAACACATGGCACATGTTTATAG
Protein Sequence: MYWKKTSLSPIRCNPYNEVRSSESNVCGVTSTTNVGHTGDSNWNDLKEHQCTVCKKQFKSKYQVNAHILRVHQKSNIQCGYCSKTFAGKNGLKMHIRSQHTDDLPYKCKTCQKRFIRQDFLNTHIKVQHLGIRYYCEKCDKQFKADVTLRNHMRLHEPSSAHKKYVCKICSKSLASKAGLHLHMTSLHGEESKVICDFCGKKYRKDRLNVHIRSHTGEKPVKCPHCEKTFTERRILTVHLRVHTKEKPYTCKICNKAFSQGGTLKIHMRFHTGERPYVCKLCDKGFASSTSLRSHMKTHGTCL

Sequence clustering based on sequence similarity using MMseqs2