Msti024612.1
Basic Information
- Insect
- Megastigmus stigmatizans
- Gene Symbol
- -
- Assembly
- GCA_900490015.1
- Location
- UELV01018138.1:1-649[-]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.3e-07 0.00012 22.6 0.0 16 35 3 23 1 32 0.84
Sequence Information
- Coding Sequence
- AGTGGAGAAGGAGTTTCTATACGGAAAGCTGCTGACATGTATCAAATGCCGAGAAGTACATTGCAGGCTAAACTCAGTTGCACCATTCAAGTTGAAGCTGCGAGGGGTCCTAGTACCTATTTGTCATATGAGGAAGAAGAAATTCTTGtgaaatggattttttattgTAGTGAAAGAGGCTTTCCTATCACAAGAAATATGCTTGTACAAAGCGTACAAAAACTTGTAATAGATTTGAAACGAGACACTCCATTTAAGAATAATCAACCTGGTAGACGCTGGCTGGATGGCTTTCTGCGTAGACACCCAAGT
- Protein Sequence
- SGEGVSIRKAADMYQMPRSTLQAKLSCTIQVEAARGPSTYLSYEEEEILVKWIFYCSERGFPITRNMLVQSVQKLVIDLKRDTPFKNNQPGRRWLDGFLRRHPS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -