Basic Information

Transcription Factor Domain

TF Family: HSF
Domain: HSF_DNA-bind domain
PFAM: PF00447
TF Group: Helix-turn-helix
Description: Heat shock factor (HSF) is a transcriptional activator of heat shock genes [1, 4]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [1]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [2]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [3]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [2]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [3]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 3 7.4e-29 8.7e-25 88.1 0.1 1 100 12 114 12 114 0.92

2 3 0.48 5.7e+03 -1.2 0.5 72 72 178 178 123 224 0.66

3 3 0.79 9.2e+03 -1.8 0.1 13 41 196 225 183 235 0.49

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	3	7.4e-29	8.7e-25	88.1	0.1	1	100	12	114	12	114	0.92
2	3	0.48	5.7e+03	-1.2	0.5	72	72	178	178	123	224	0.66
3	3	0.79	9.2e+03	-1.8	0.1	13	41	196	225	183	235	0.49

Coding Sequence: ATGTACGACGATTGTATATTTCTATCGCTGCGATTTCCGCAAAAATTATGGCGGATCGTGAACGAATGCAAGAGCGGTGCCATCCGGTGGAGTTTGAGCGGCAACACTATACTCCTGGATTACAAGAAGTTTCAGGAACAATATTTGGACGCGGGCAACTCCATCTTCAAGACGAAGAACATCACCAGCTTCATCAGACAGTTGAACCTTTATGGCTTCCGGAAGGTTACCTCGCACAATCGGGATCCTATTTGCAACTCCCATAATCCGGATGTGCACGAGTTTCTGCACGAAAACTTCCGAACAGGAAGACCCGACCTCCTGTCTAGGGTGTACAGGAAAACGGCTGGAAAGGTGAAACACTGTCATCGTGTTAATTCGAAAAACACCACCGAAGAATTTTTGAATAAGGACTCTGATCACGTGTCGCGTTTGCACATGTGTCGGTTGGCATTAACAAAAACCTTAGAACAGATATCGCGGGAATATCAGAAAACGCAAAACCATGAAACCAAAGACAAACATTCCTTGAACTCCTTAAACTCCCATGAAAAAGtattcAGTCTTAATTTATATACTACACAAGCCCATGACTCAAACATGAATTGGATTACAAGAAATTCGGTATCAATTGCTTCAAAAAAGGATAATTCGATCAACCGACGATTCATTCCCAGTGTTTACGTAAAATGGACAGATTTCTCGAAAAATAACTGA
Protein Sequence: MYDDCIFLSLRFPQKLWRIVNECKSGAIRWSLSGNTILLDYKKFQEQYLDAGNSIFKTKNITSFIRQLNLYGFRKVTSHNRDPICNSHNPDVHEFLHENFRTGRPDLLSRVYRKTAGKVKHCHRVNSKNTTEEFLNKDSDHVSRLHMCRLALTKTLEQISREYQKTQNHETKDKHSLNSLNSHEKVFSLNLYTTQAHDSNMNWITRNSVSIASKKDNSINRRFIPSVYVKWTDFSKNN

Sequence clustering based on sequence similarity using MMseqs2