Mlea008135.1
Basic Information
- Insect
- Megachile leachella
- Gene Symbol
- lz
- Assembly
- GCA_963576845.1
- Location
- OY756249.1:1580504-1581455[+]
Transcription Factor Domain
- TF Family
- Runt
- Domain
- Runt domain
- PFAM
- PF00853
- TF Group
- Beta-Scaffold Factors
- Description
- The AML1 gene is rearranged by the t(8;21) translocation in acute myeloid leukemia [1]. The gene is highly similar to the Drosophila melanogaster segmentation gene runt and to the mouse transcription factor PEBP2 alpha subunit gene [1]. The region of shared similarity, known as the Runt domain, is responsible for DNA-binding and protein-protein interaction.In addition to the highly-conserved Runt domain, the AML-1 gene product carries a putative ATP-binding site (GRSGRGKS), and has a C-terminal region rich in proline and serine residues. The protein (known as acute myeloid leukemia 1 protein, oncogene AML-1, core-binding factor (CBF), alpha-B subunit, etc.) binds to the core site, 5'-pygpyggt-3', of a number of enhancers and promoters.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 2.9e-53 2e-49 167.4 0.0 4 95 42 133 39 135 0.97
Sequence Information
- Coding Sequence
- ATGCAGTTGACAGAAGCCTCGACTCCTGGCGCTGCCGCATCGCCGGAGTCGGGCGTTTCTCCTCTGACCGATGCCTACACCAAGATGACCAGCGATATCCTCGCGGAAAGGACTCTCGGCGATTTCGTCAGCGAGCATCCTGGAGAACTGGTCCGAACAGGTTCACCCCACTTGGTCTGCACCGTTCTCCCAGCGCACTGGAGGTCGAACAAGACCCTTCCAGTAGCGTTCAAGGTCGTAGCCCTCGGCGAGGTAGGCGATGGCACTCTGGTGACCGTTCGTGCTGGCAACGACGAGAACTGCTGTGCCGAGTTAAGAAATTCCACCGCGCTGATGAAGAATCAAGTTGCCAAGTTCAACGATTTGAGGTTCGTCGGAAGAAGCGGAAGAGGTAAGTCTCCCATTTAA
- Protein Sequence
- MQLTEASTPGAAASPESGVSPLTDAYTKMTSDILAERTLGDFVSEHPGELVRTGSPHLVCTVLPAHWRSNKTLPVAFKVVALGEVGDGTLVTVRAGNDENCCAELRNSTALMKNQVAKFNDLRFVGRSGRGKSPI
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -