Basic Information

Insect: Marronus borbonicus
Gene Symbol: -
Assembly: GCA_902655005.1
Location: LR737382.1:15259376-15260326[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.71 58 4.5 0.1 1 23 30 52 30 52 0.91

2 10 0.00011 0.0093 16.5 0.6 1 23 56 79 56 79 0.97

3 10 0.036 3 8.6 0.1 1 23 84 107 84 107 0.95

4 10 0.034 2.8 8.7 1.9 1 23 113 135 113 135 0.94

5 10 9.2e-05 0.0075 16.7 0.7 2 23 142 164 141 164 0.95

6 10 3.1e-07 2.6e-05 24.5 0.9 2 23 176 197 175 197 0.98

7 10 1.4e-05 0.0011 19.3 1.8 3 23 209 229 207 229 0.96

8 10 4.1e-05 0.0034 17.8 5.8 1 23 235 257 235 257 0.98

9 10 6.6e-05 0.0054 17.2 4.6 1 23 263 285 263 285 0.97

10 10 0.0008 0.066 13.8 0.1 1 21 291 311 291 312 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.71	58	4.5	0.1	1	23	30	52	30	52	0.91
2	10	0.00011	0.0093	16.5	0.6	1	23	56	79	56	79	0.97
3	10	0.036	3	8.6	0.1	1	23	84	107	84	107	0.95
4	10	0.034	2.8	8.7	1.9	1	23	113	135	113	135	0.94
5	10	9.2e-05	0.0075	16.7	0.7	2	23	142	164	141	164	0.95
6	10	3.1e-07	2.6e-05	24.5	0.9	2	23	176	197	175	197	0.98
7	10	1.4e-05	0.0011	19.3	1.8	3	23	209	229	207	229	0.96
8	10	4.1e-05	0.0034	17.8	5.8	1	23	235	257	235	257	0.98
9	10	6.6e-05	0.0054	17.2	4.6	1	23	263	285	263	285	0.97
10	10	0.0008	0.066	13.8	0.1	1	21	291	311	291	312	0.95

Sequence Information

Coding Sequence: ATGCTGAATCGACACACGAAGGGGTGCTACGTTAAGCCATCCAAAGAGATCCATTACAGTTATATCTACAACGAAAACGAAGGGAATTTCTCGTGTAAAACGTGCGACGTCGAGATGGAAAGTAAGGAGAAGATCGAAGAGCACGTCTTGGTACACGAAGATAAGTTCCAGTGCGTGATATGTAACGAAATCTTCTATTCGGCCTATCAGTTCTCTGTTCATGTAAAGAGGCAACACGACGATATCGTCTATAGATGTCCTCTGTGCGAATACATCACTCCTAGGGTGACGTCGATTGCGCAACACATTAATCTCATGCATCTCAAGAAATACCTTCATAATTGTCAGTTTTGCGGTAAGGGTTTCCACGATGTTGCTGTTTTTAGAGAGCACGAGAACGTGCACATGGGAGCCGGGCCTATAACTTGCGTAGTCTGTCAGAAACAATTTTCCTACTCGAGAAATTTATTAATGCATCAGATTCGAAATCACACCGCCACAATTGCCGGCGTCCTTCTATCCAACCAATGTTCTGTATGCAAAAGAGTATTCTCCCGACCGAATTCCTTAAATTCCCACATGAAAATCCACGAGAGGAAAAAGCCATTAGAGAAAACCCATCTTTGCGATACTTGCGGCAAAGGCTTCGCCAGAAAGAATAAATTGATGCTGCACTACAGGGTGCACACCGGGTATAAACCTCATAAATGTAGCTATTGCGAGAAATGTTTCACTAAAAGAGATTATCTTGTGCTCCACGAGAGGATTCATAGCGGTGAGAAGCCCTATTGTTGCGTTTTCTGCGGAAAATGCTTCAATCAGGATACGGCGCTAAGAATCCATTTGAGAAGTCATACCGGAGAACGTCCTTACGTTTGTGAATTTTGTAATAACGGTTTTATTTCGAGAGGTTCCCTAAAGGTGCATCAAATTAGTTGCACCGGTTGTTGA
Protein Sequence: MLNRHTKGCYVKPSKEIHYSYIYNENEGNFSCKTCDVEMESKEKIEEHVLVHEDKFQCVICNEIFYSAYQFSVHVKRQHDDIVYRCPLCEYITPRVTSIAQHINLMHLKKYLHNCQFCGKGFHDVAVFREHENVHMGAGPITCVVCQKQFSYSRNLLMHQIRNHTATIAGVLLSNQCSVCKRVFSRPNSLNSHMKIHERKKPLEKTHLCDTCGKGFARKNKLMLHYRVHTGYKPHKCSYCEKCFTKRDYLVLHERIHSGEKPYCCVFCGKCFNQDTALRIHLRSHTGERPYVCEFCNNGFISRGSLKVHQISCTGC

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00627659;
90% Identity: iTF_00627659;
80% Identity: iTF_01121080;