Mjur014118.1
Basic Information
- Insect
- Maniola jurtina
- Gene Symbol
- CAMTA1_1
- Assembly
- GCA_905333055.1
- Location
- HG995222.1:12594914-12597728[-]
Transcription Factor Domain
- TF Family
- CG-1
- Domain
- CG-1 domain
- PFAM
- PF03859
- TF Group
- Unclassified Structure
- Description
- CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [2]. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 8.6e-24 2e-19 69.8 0.6 27 80 22 74 11 98 0.90
Sequence Information
- Coding Sequence
- ATGGCCAAATCCTACTCTGAGAGGAGACCCATGCTCAGTATCGGCAATGGGATGATGATGAATGTAGAGAAGATAAAAAGAAGACCGAAAAGTGGGTCGATGCTTCTGTACAGCCGCAAGAAAGTTCGCTACCGACGCGACGGGTACTGTTGGAAGAAGAGGAAAGACGGGAAGACCACTCGAGAAGACCACATGAAGCTCAAGGTGCAGGGGACTGAGACTTCCTACAAGAAGGAACTCGACAAGATCAAAAAGTCTATGAAGTTCTTCGCTTTTTCTTCCATCGCGGATGACAAGTTTCTCGTCTGA
- Protein Sequence
- MAKSYSERRPMLSIGNGMMMNVEKIKRRPKSGSMLLYSRKKVRYRRDGYCWKKRKDGKTTREDHMKLKVQGTETSYKKELDKIKKSMKFFAFSSIADDKFLV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -