Basic Information

Insect: Malthinus seriepunctatus
Gene Symbol: -
Assembly: GCA_963924605.1
Location: OZ004602.1:9909472-9910362[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.14 9.9 7.3 6.3 1 23 15 38 15 38 0.96

2 10 1e-05 0.00072 20.3 1.9 2 23 44 66 44 66 0.93

3 10 3.5e-05 0.0024 18.7 0.8 1 23 74 96 74 96 0.95

4 10 0.19 14 6.9 0.9 1 23 102 125 102 125 0.94

5 10 6.7e-05 0.0047 17.8 1.7 1 23 130 152 130 152 0.98

6 10 0.00019 0.013 16.4 1.3 1 23 161 183 161 183 0.98

7 10 2e-06 0.00014 22.6 0.7 1 23 189 211 189 211 0.96

8 10 2.4e-07 1.7e-05 25.5 0.3 1 23 217 239 217 239 0.98

9 10 7e-08 4.9e-06 27.2 3.5 1 23 245 267 245 267 0.98

10 10 1.2e-06 8.1e-05 23.3 0.4 1 23 273 295 273 295 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.14	9.9	7.3	6.3	1	23	15	38	15	38	0.96
2	10	1e-05	0.00072	20.3	1.9	2	23	44	66	44	66	0.93
3	10	3.5e-05	0.0024	18.7	0.8	1	23	74	96	74	96	0.95
4	10	0.19	14	6.9	0.9	1	23	102	125	102	125	0.94
5	10	6.7e-05	0.0047	17.8	1.7	1	23	130	152	130	152	0.98
6	10	0.00019	0.013	16.4	1.3	1	23	161	183	161	183	0.98
7	10	2e-06	0.00014	22.6	0.7	1	23	189	211	189	211	0.96
8	10	2.4e-07	1.7e-05	25.5	0.3	1	23	217	239	217	239	0.98
9	10	7e-08	4.9e-06	27.2	3.5	1	23	245	267	245	267	0.98
10	10	1.2e-06	8.1e-05	23.3	0.4	1	23	273	295	273	295	0.98

Sequence Information

Coding Sequence: ATGGCAGATAACGTTGTGCTTTTACTGGGTAAAGCGACCAAACACGAATGTAAAAAGTGTAACCTCTTTTTCCACGAATATAGAGAATTACTAAATCATAGGAACCGCACGCATAGAGTCAGAAAACGTTCTTGTAATATGTGCgacaaaaagttttataataattctctTCTTAAACGTCATGAAATGCTAAAGCATAGTGGAGAGCGGCCACGTCCTTTCTTATGTGAAGTTTGTAACAAGGGCTATACATCAGAGACAACTTTGAAAAAACACCAAGTAACACATACCCGCAATTATAAATATAAGTGCGATCAATGCGACAACGGTTACCACTATGAAAAAGTCTTGGAAGAACATTATGCACGAGTACACGCAGGACTACGATACGAATGTGAAATTTGTCATAAATTGTATACCACCCTTGAATACCTTGAAGTACACAAACGCCAACACGATccaaattatgttaaaaaggaGTACAGTTGTGATAAATGTGATAAGATATCATACAGTCTTTCAGCCTTCAGAGAACATTTGAAAAAACACAATGGACTTAATAACCATATTTGTTACATTTGTGGAAAGAGTGTTACTACTGCAAGCAGTTTAAAGACGCATATTAAAGCTCATAATAACGACAAACAATATGCTTGTGATGTTTGCGGTAAAGCTTTTGTAGCTAAAAATTACTTACGTACTCATATGCGCACACATACTAAAGAAAAACCTTTCAAATGTTCGATTTGCAATAAATGTTTCACTCAAAGGAGTTCATTGGTTATTCATATGAGGGACCACACTGGAGAAAAACCTTATAAATGTCAAGTTTGTGAAAAAGTATTTGTTACTAGCAGTTTGTTAAAATTGCATGTCGCAAAACATAATTAA
Protein Sequence: MADNVVLLLGKATKHECKKCNLFFHEYRELLNHRNRTHRVRKRSCNMCDKKFYNNSLLKRHEMLKHSGERPRPFLCEVCNKGYTSETTLKKHQVTHTRNYKYKCDQCDNGYHYEKVLEEHYARVHAGLRYECEICHKLYTTLEYLEVHKRQHDPNYVKKEYSCDKCDKISYSLSAFREHLKKHNGLNNHICYICGKSVTTASSLKTHIKAHNNDKQYACDVCGKAFVAKNYLRTHMRTHTKEKPFKCSICNKCFTQRSSLVIHMRDHTGEKPYKCQVCEKVFVTSSLLKLHVAKHN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -