Basic Information

Insect: Macrosiphum euphorbiae
Gene Symbol: -
Assembly: GCA_949089665.1
Location: CARXXK010000002.1:50604595-50606145[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 18 6.8e-08 8.9e-06 27.8 0.5 1 23 14 36 14 36 0.99

2 18 3.1e-07 4e-05 25.7 0.7 1 23 42 64 42 64 0.98

3 18 1.4e-07 1.8e-05 26.8 0.7 1 23 70 92 70 92 0.99

4 18 2.6e-06 0.00034 22.8 3.3 1 23 98 120 98 120 0.98

5 18 0.00016 0.021 17.1 0.4 1 23 126 148 126 148 0.97

6 18 1.2e-06 0.00015 23.9 2.7 1 23 154 176 154 176 0.97

7 18 1.1e-06 0.00014 24.0 2.3 1 23 182 204 182 204 0.98

8 18 0.0002 0.026 16.9 2.1 1 23 210 232 210 232 0.97

9 18 0.0007 0.091 15.1 2.5 1 23 238 260 238 260 0.98

10 18 2.1e-06 0.00027 23.1 5.9 1 23 266 288 266 288 0.98

11 18 1.8e-07 2.4e-05 26.4 0.4 3 23 296 316 294 316 0.97

12 18 0.00013 0.016 17.5 3.1 1 23 322 344 322 344 0.98

13 18 0.0007 0.091 15.1 2.5 1 23 350 372 350 372 0.98

14 18 2.1e-06 0.00027 23.1 5.9 1 23 378 400 378 400 0.98

15 18 0.00027 0.035 16.5 0.8 1 23 406 428 406 428 0.97

16 18 1.8e-07 2.4e-05 26.4 0.7 1 23 434 456 434 456 0.97

17 18 2.8e-07 3.6e-05 25.8 0.5 1 23 462 484 462 484 0.98

18 18 0.00012 0.016 17.5 4.9 1 23 490 512 490 512 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	18	6.8e-08	8.9e-06	27.8	0.5	1	23	14	36	14	36	0.99
2	18	3.1e-07	4e-05	25.7	0.7	1	23	42	64	42	64	0.98
3	18	1.4e-07	1.8e-05	26.8	0.7	1	23	70	92	70	92	0.99
4	18	2.6e-06	0.00034	22.8	3.3	1	23	98	120	98	120	0.98
5	18	0.00016	0.021	17.1	0.4	1	23	126	148	126	148	0.97
6	18	1.2e-06	0.00015	23.9	2.7	1	23	154	176	154	176	0.97
7	18	1.1e-06	0.00014	24.0	2.3	1	23	182	204	182	204	0.98
8	18	0.0002	0.026	16.9	2.1	1	23	210	232	210	232	0.97
9	18	0.0007	0.091	15.1	2.5	1	23	238	260	238	260	0.98
10	18	2.1e-06	0.00027	23.1	5.9	1	23	266	288	266	288	0.98
11	18	1.8e-07	2.4e-05	26.4	0.4	3	23	296	316	294	316	0.97
12	18	0.00013	0.016	17.5	3.1	1	23	322	344	322	344	0.98
13	18	0.0007	0.091	15.1	2.5	1	23	350	372	350	372	0.98
14	18	2.1e-06	0.00027	23.1	5.9	1	23	378	400	378	400	0.98
15	18	0.00027	0.035	16.5	0.8	1	23	406	428	406	428	0.97
16	18	1.8e-07	2.4e-05	26.4	0.7	1	23	434	456	434	456	0.97
17	18	2.8e-07	3.6e-05	25.8	0.5	1	23	462	484	462	484	0.98
18	18	0.00012	0.016	17.5	4.9	1	23	490	512	490	512	0.98

Sequence Information

Coding Sequence: ATGACGACACACCAGCGGACGTATATGAAGATGAAAGCTTATccatgcgatgtatgcgacatgTCATTCAGTCAAAGTAGTGGTCTGACAAGACATCGACGGACCCATACTGGCGAGAAACCATACGCATGTGATATATGCGAAAAATCGTTTACTGAAAGTGGCTCATTGACGAGACATCGTAGGACTCACACGGGCGAGAAACCATTCAAATGCGATATATGTGACATGTCGTTCAGTCAAAGTGGGAATTTGATAAGTCATCGACGATCCCACACTGGTGAGAAGCCTTTTGCGTGCGATATATGTGACAAATCGTTTGCTACAAGTCATACTTTGATGGATCATCATCGGACTCACACGGGCGAGAAACCATTTgcgtgcgatgtatgcgacaagtcgttcgctGAAAGTGGCTCATTGACGTTTCATCGTAGGACTCACACAGGGGAGAGACCATTTGCGTGTGATGTATGTAACATGTCATTCAGTCAAAGTGGTCATTTGACAAGACATCGACGGAAACACACTGGCGAGAAGCCTTTTGCATGCGATATATGTGAAAAATCGTTTGCTACAAGTTACACTCTGACGAATCATCATCGGACTCACACGGGCGAGAAACCATTTgcgtgcgatgtatgcgacaagtcgttctctgaaAGTGGCACATTGACGTGTCATCGTAGGACTCACACGGGTGAAAAGCCTTTTGAGTGCGATATATGTGACAAATCGTTTGCTGCGAGTTTCACATTGACGTGTCATCGTAGGACTCACACGGGTGAAAAGCCATTTGTTTGCGATTTATGTGACAAATCGTTTACTACAAGTCACACTCTGACGAATCATCATCGGACTCACACGGGCGAGAAACCATTAgcgtgcgatgtatgcgacaagtcgttcagTCAAAGTGGCGGTTTGACTAGACATCGCAGGACTCACAATGGCCAGAAACCATTTAcgtgcgatgtatgcgacaagtcgttctctgaaAGTGGCACATTGACGTGTCATCGTAGGACTCACACGGGTGAAAAGCCTTTTGAGTGCGATATATGTGACAAATCGTTTGCTGCGAGTTTCACATTGACGTGTCATCGTAGGACTCACACGGGTGAAAAGCCATTTGTTTGCGATTTATGTGACAAATCGTTTACTACAAGTCACACTCTGACGAATCATCATCGGACTCACACGGGCGAGAAACCATTTgcgtgcgatgtatgcgacaagtcgttcgctGAAAGTGGCGCATTGACGTGTCATCGTAGGACTCACACGGGTGAAAAGCCATTTGCGTGCGATGTATGCGAGAAGTCATTCAGTAATAGTAGTAGTTTGATTTCTCATCGACGAACCCACACGGGCGAGAAACCATACGCATGCAATGTATGCGACATGTCGTTCAGTCAAAGTGGCGGTTTGACTAGACATCGCAGGACTCACAATGGCCAGAAACCATTTACGTGCGATCTATGTAATAGGTCGTTTGCTAAATGTAGAAATTTAACGATACACAAGCGGAAACACACTTTAGTTCTATGA
Protein Sequence: MTTHQRTYMKMKAYPCDVCDMSFSQSSGLTRHRRTHTGEKPYACDICEKSFTESGSLTRHRRTHTGEKPFKCDICDMSFSQSGNLISHRRSHTGEKPFACDICDKSFATSHTLMDHHRTHTGEKPFACDVCDKSFAESGSLTFHRRTHTGERPFACDVCNMSFSQSGHLTRHRRKHTGEKPFACDICEKSFATSYTLTNHHRTHTGEKPFACDVCDKSFSESGTLTCHRRTHTGEKPFECDICDKSFAASFTLTCHRRTHTGEKPFVCDLCDKSFTTSHTLTNHHRTHTGEKPLACDVCDKSFSQSGGLTRHRRTHNGQKPFTCDVCDKSFSESGTLTCHRRTHTGEKPFECDICDKSFAASFTLTCHRRTHTGEKPFVCDLCDKSFTTSHTLTNHHRTHTGEKPFACDVCDKSFAESGALTCHRRTHTGEKPFACDVCEKSFSNSSSLISHRRTHTGEKPYACNVCDMSFSQSGGLTRHRRTHNGQKPFTCDLCNRSFAKCRNLTIHKRKHTLVL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00942466;
90% Identity: iTF_00942466;
80% Identity: iTF_00942466;