Mrus002951.1
Basic Information
- Insect
- Machimus rusticus
- Gene Symbol
- esr1
- Assembly
- GCA_951509405.1
- Location
- OX608049.1:20105635-20106306[-]
Transcription Factor Domain
- TF Family
- ESR
- Domain
- zf-C4|ESR-like
- PFAM
- AnimalTFDB
- TF Group
- Zinc-Coordinating Group
- Description
- This entry represents CLAVATA3/ESR (CLE)-related protein 14 from Arabidopsis thaliana (CLE14) and similar proteins predominantly found in plants. CLE14 is an extracellular signal peptide that regulates cell fate. It represses root apical meristem maintenance and functions as an elicitor of the root meristem differentiation through the CLV2/CRN complex signalling pathway. This protein inhibits irreversibly root growth by reducing cell division rates in the root apical meristem [1, 2].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4.4e-21 6.3e-17 63.4 0.1 69 113 22 66 3 67 0.85 2 2 2e-26 2.9e-22 80.9 1.3 165 267 66 165 66 166 0.99
Sequence Information
- Coding Sequence
- ATGGATCTTCTCAATACAGACTGTGATGACAAATCAACTGTCTTTGaagacaaaacaaaattagccGCCGATTCTCATGAAATATTGAGCATTATGAGCGATCTATACGATAGAGAGCTGGTCGGTGTTATTGGCTGGGCCAAACAAATTCCAGGCTTTACAGAACTACCTCTGAACGATCAAATGAAACTTCTTCAGAGACTGGAAAGGCTGTCCCCCAGAAAGAAGGAATACTATTTATTGAAAGCTTTAGCATTGTCCAACTGTGATATCCGATTGGACGATCAGTTTATGTTAAGGAAGTTTAGTGACTCTATTTTAAGTGCGCTCAACGACTGTTTCTATTTACTTAGACACAATTCAGCTGTATCTCACCAGCGGCAGTTGTTGCTCTTGTTACCGGCACTTCGGCAGGCCGATCAGATTATTCGCAAATTCTGGGTGAACATATGCCGGGAAGGAAATGTGACAATGAACAAACTATTCGTGGAAATGTCTATCttcttttttgattaa
- Protein Sequence
- MDLLNTDCDDKSTVFEDKTKLAADSHEILSIMSDLYDRELVGVIGWAKQIPGFTELPLNDQMKLLQRLERLSPRKKEYYLLKALALSNCDIRLDDQFMLRKFSDSILSALNDCFYLLRHNSAVSHQRQLLLLLPALRQADQIIRKFWVNICREGNVTMNKLFVEMSIFFFD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00937381;
- 90% Identity
- iTF_00937381;
- 80% Identity
- iTF_00937381;