Mlit008543.1
Basic Information
- Insect
- Macaria liturata
- Gene Symbol
- grn_2
- Assembly
- GCA_964023185.1
- Location
- OZ026811.1:10183170-10186509[+]
Transcription Factor Domain
- TF Family
- zf-GATA
- Domain
- zf-GATA domain
- PFAM
- PF00320
- TF Group
- Zinc-Coordinating Group
- Description
- This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 3 0.21 1.4e+03 -0.5 0.3 20 20 24 24 8 35 0.53 2 3 0.22 1.5e+03 -0.5 0.4 11 16 29 35 25 42 0.64 3 3 2.5e-20 1.7e-16 60.1 6.8 1 35 78 111 78 112 0.97
Sequence Information
- Coding Sequence
- ATGGGGATAAGAGGAAAATTTGAGTGCGGAAACAGGTTCGGTAAATGGATTGCCTCCCCCTCGGGGGCTCTCGCGGCGGGATCTAGATGGCGTAGATACGCTGATAGCGGCTGTGTGCGCGTGTGCGTGTGTCCATGTGTGCGCCTGTTTTCCGGATACGAGCGTGTAGTTATTTTCTTGTTATTTGTTCGGCAGTCGCTGCAGAGCGCAGCGCGGCGCGCGGGGACCTCGTGTGCTAACTGCAAGACTACCACCACCACACTGTGGAGACGCAACCAGAACGGGGAGCCAGTGTGCAACGCCTGTGGACTCTACTATAAACTACATAATGTGAGTACTTTAGCTTTATTTTTCGGTTAA
- Protein Sequence
- MGIRGKFECGNRFGKWIASPSGALAAGSRWRRYADSGCVRVCVCPCVRLFSGYERVVIFLLFVRQSLQSAARRAGTSCANCKTTTTTLWRRNQNGEPVCNACGLYYKLHNVSTLALFFG
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -