Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.5 7.3e+03 -3.2 0.2 15 17 4 6 3 6 0.59

2 7 8.1e-06 0.038 13.7 3.8 9 19 19 29 18 29 0.93

3 7 1.3 6.2e+03 -3.0 3.5 6 7 58 59 50 63 0.58

4 7 3 1.4e+04 -5.9 11.5 14 19 65 70 57 70 0.72

5 7 1.7 8.3e+03 -3.4 0.4 6 10 73 77 73 77 0.80

6 7 0.76 3.6e+03 -2.2 0.8 15 18 96 100 95 101 0.54

7 7 1.3e-09 6.2e-06 25.8 14.9 1 19 106 125 106 125 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.5	7.3e+03	-3.2	0.2	15	17	4	6	3	6	0.59
2	7	8.1e-06	0.038	13.7	3.8	9	19	19	29	18	29	0.93
3	7	1.3	6.2e+03	-3.0	3.5	6	7	58	59	50	63	0.58
4	7	3	1.4e+04	-5.9	11.5	14	19	65	70	57	70	0.72
5	7	1.7	8.3e+03	-3.4	0.4	6	10	73	77	73	77	0.80
6	7	0.76	3.6e+03	-2.2	0.8	15	18	96	100	95	101	0.54
7	7	1.3e-09	6.2e-06	25.8	14.9	1	19	106	125	106	125	0.97

Coding Sequence: CTGTTCCGTTGTCAACCTTCATACTCGTGCAATAGTAGATTCATTATCCACTATACTTGCCATAGTGGACGTTGCCCACAATGTCAAGAAACTAGTTTCGATGAATTATATTGTGAATGTGGTGCTAATGTTATTTATCCACCAATACCATGTGGtacaaaaccaccaccatgTACAAATCCATGTTCACGTCAATGTCCACCATGTACAGTTCTATGTAAACGTTGGTGTTTTGGTAAACATGAACAACGTTCAGCTATACTATGTTATCAAGAAGATTTCAGTTGTGGTTTACCATGTGGACGATCATTACCATGCGGTAAACATAGATGTGATAAACCATGTCATTTAGGTCCATGTCCATTACCATGTAAACAGAAATGTACAGTAAAACGTACATTATGA
Protein Sequence: LFRCQPSYSCNSRFIIHYTCHSGRCPQCQETSFDELYCECGANVIYPPIPCGTKPPPCTNPCSRQCPPCTVLCKRWCFGKHEQRSAILCYQEDFSCGLPCGRSLPCGKHRCDKPCHLGPCPLPCKQKCTVKRTL

Sequence clustering based on sequence similarity using MMseqs2