Basic Information

Transcription Factor Domain

TF Family: CG-1
Domain: CG-1 domain
PFAM: PF03859
TF Group: Unclassified Structure
Description: CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [2]. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0014 41 4.7 0.0 93 114 15 36 5 38 0.89

2 5 0.0015 45 4.5 0.0 93 114 71 92 54 94 0.86

3 5 0.00081 25 5.4 0.0 93 114 127 148 113 150 0.90

4 5 0.00081 25 5.4 0.0 93 114 183 204 169 206 0.90

5 5 0.0014 44 4.6 0.0 93 114 239 260 224 262 0.89

#	of	c-Evalue	i-Evalue	score	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0014	41	4.7	93	114	15	36	5	38	0.89
2	5	0.0015	45	4.5	93	114	71	92	54	94	0.86
3	5	0.00081	25	5.4	93	114	127	148	113	150	0.90
4	5	0.00081	25	5.4	93	114	183	204	169	206	0.90
5	5	0.0014	44	4.6	93	114	239	260	224	262	0.89

Coding Sequence: ATGTTGTTCATTACTCCGGCAAGAGCTCGCAACTCTATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGCTCGCAACTCTATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCATGAGGTCGCAACTCTATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGCTCGCAACTCTATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCATGAGGTCGCAACTCTATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGGTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGGTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGGTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGGTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGGTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGGTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGCTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGCTCGCAACTATATTGGTGCGCTATCTCGTCGATGTTGTTCATTACTCCGGCAAGAGCTCGCAACTCTTTTGGTGCGCTATCTCGTCGATGACTTAATAAAGTGCGGCCGAGAATAA
Protein Sequence: MLFITPARARNSIGALSRRCCSLLRQELATLLVRYLVDVVHYSGMRSQLYWCAISSMLFITPARARNSIGALSRRCCSLLRHEVATLLVRYLVDVVHYSGKRSQLYWCAISSMLFITPARGRNYIGALSRRCCSLLRQEVATILVRYLVDVVHYSGKRSQLYWCAISSMLFITPARGRNYIGALSRRCCSLLRQEVATILVRYLVDVVHYSGKSSQLYWCAISSMLFITPARARNYIGALSRRCCSLLRQELATLLVRYLVDDLIKCGRE

Sequence clustering based on sequence similarity using MMseqs2