Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.089 1.5e+02 2.9 1.3 16 41 1 23 1 26 0.81

2 7 0.00013 0.22 12.0 0.7 12 40 137 162 132 164 0.85

3 7 1.7e-05 0.028 14.8 1.6 11 40 166 192 163 194 0.89

4 7 1.9e-05 0.032 14.6 5.2 3 40 187 222 186 224 0.87

5 7 3.8e-05 0.063 13.7 2.1 11 40 226 252 223 254 0.88

6 7 1.3e-05 0.022 15.1 4.6 5 40 249 282 247 284 0.85

7 7 0.00089 1.5 9.3 0.8 11 28 286 303 282 312 0.80

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.089	1.5e+02	2.9	1.3	16	41	1	23	1	26	0.81
2	7	0.00013	0.22	12.0	0.7	12	40	137	162	132	164	0.85
3	7	1.7e-05	0.028	14.8	1.6	11	40	166	192	163	194	0.89
4	7	1.9e-05	0.032	14.6	5.2	3	40	187	222	186	224	0.87
5	7	3.8e-05	0.063	13.7	2.1	11	40	226	252	223	254	0.88
6	7	1.3e-05	0.022	15.1	4.6	5	40	249	282	247	284	0.85
7	7	0.00089	1.5	9.3	0.8	11	28	286	303	282	312	0.80

Coding Sequence: ATGATTGAGTgtgcaatttgcaaatttgtatttaataataaaaagcaaTACAAATCACACCTCAAATCTAAAACACATTTGGGCAACCTCAAAGTGTTTAAATCAGTTGAGGAGTTCCAGAAGTATTATGGGGCTTCGCCACTGCCGCCTCATCATCCGCAGCCGGAGGTAACGCTTGCCAAGGCGCCTCCTTTGTCAGGCAATGCTACGCCACCTACCATAATCCGCTCTGATGATCAGGTCTCACTGAAGTCTTCacagccgccgccaccgccacctaCGCCTGCGCCTCGGACCTTGCCAGATCAAATACAACCCATGGTCCCAACCACAGTGTCCTTCTCCTCAGAGGATGACGATGACAATGACCTGATCCCGAGTACGCCTCAGACTCCGACCATTGATGAGAACACAAACACACGACCACAGTGTCCAcattgtgagaaaacctttgcgACTGCAAGGAATCTCAAACGGcacatgaaattgcatgatgagACTAGGGAGAAGAAATACCAGTGTCAACATTGTGAGAACACCTTTGCGTATGCATGGAATCTCAAACGGcacatgaaattgcatgatgagACTAGGGAGAAGAAATACCAGTGTCAACATTGTGAGAAGACCTTTGCGTATGCAAGGACTCTCAAACGGcacatgaaattgcatgatgagACTAGGGAGAAGAAATACCAGTGTCAACATTGTGAGAATACCTTTGCGTATGCAAGGACTCTCAAACGGcacatgaaattgcatgatgagACTAGGGAGAAGAAATACCAGTGTCAACATTGTGAGAATACCTTTGCGTATGCAAGGAATCTCAAACGGcacatgaaattgcatgatgagACTAGGGAGAAGAAATACCAGTGTCAACATTGTGAGAATACCTTTGCTACGGTACCCGAAACTGAAACTGCCACAATGGATGACGATGTTACTCCCGCCATTATTCACATATTGGCTGGCCGCTTGCCTAAGCCTCTGCCCCTGGCTCCAATATTTTCCGAACCCGCTGACAGTCCTTCTCCTCAGAAGATGACGATGACAATGACCTGA
Protein Sequence: MIECAICKFVFNNKKQYKSHLKSKTHLGNLKVFKSVEEFQKYYGASPLPPHHPQPEVTLAKAPPLSGNATPPTIIRSDDQVSLKSSQPPPPPPTPAPRTLPDQIQPMVPTTVSFSSEDDDDNDLIPSTPQTPTIDENTNTRPQCPHCEKTFATARNLKRHMKLHDETREKKYQCQHCENTFAYAWNLKRHMKLHDETREKKYQCQHCEKTFAYARTLKRHMKLHDETREKKYQCQHCENTFAYARTLKRHMKLHDETREKKYQCQHCENTFAYARNLKRHMKLHDETREKKYQCQHCENTFATVPETETATMDDDVTPAIIHILAGRLPKPLPLAPIFSEPADSPSPQKMTMTMT

Sequence clustering based on sequence similarity using MMseqs2