Lnyc008972.1
Basic Information
- Insect
- Listrodromus nycthemerus
- Gene Symbol
- Cebpg_1
- Assembly
- GCA_963978505.1
- Location
- OZ021683.1:18860619-18861134[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 7 5.1e+03 -2.5 0.2 19 24 12 17 3 21 0.51 2 2 2.4e-15 1.7e-12 47.0 7.1 3 65 25 87 23 87 0.95
Sequence Information
- Coding Sequence
- ATGGCGTCgaggaataaagaaaactcttcgggaaataggaagaaaaaagttctCTCCGAGGAGGACGACAGCGAGGATTACAGGAGACGTCGCGATCGAAATAATCAGGCGGTAAAACGATCGAGAGTTAAGAGCAAAATGCGAACACAGCAGACACTAGAGCGAGTAAACCAATTAAAAACTGAGAACGAATTGCTGGAGGAGAAGATCAAGATGCTGACGAAAGAGCTTGGATTCCTGAAAGACTTGTTTCTCGCTCACGCCAGCTCGAACCAACACGCTCCGAACCTCCAAGACTTCGATCTGAACGCTCTCCTGGCGGAGGAATCGAAAATAGTCGATTAA
- Protein Sequence
- MASRNKENSSGNRKKKVLSEEDDSEDYRRRRDRNNQAVKRSRVKSKMRTQQTLERVNQLKTENELLEEKIKMLTKELGFLKDLFLAHASSNQHAPNLQDFDLNALLAEESKIVD
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01098951;
- 90% Identity
- iTF_00057672;
- 80% Identity
- -