Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0002 0.2 13.0 4.0 18 38 93 114 81 117 0.91

2 6 0.0031 3.1 9.1 0.8 15 32 118 136 115 142 0.76

3 6 0.0036 3.6 8.9 3.7 5 33 133 165 132 171 0.77

4 6 0.012 12 7.2 3.0 5 36 165 192 162 197 0.73

5 6 0.0038 3.8 8.9 2.1 14 38 201 226 193 233 0.80

6 6 0.21 2.1e+02 3.3 2.9 10 28 226 243 221 244 0.70

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0002	0.2	13.0	4.0	18	38	93	114	81	117	0.91
2	6	0.0031	3.1	9.1	0.8	15	32	118	136	115	142	0.76
3	6	0.0036	3.6	8.9	3.7	5	33	133	165	132	171	0.77
4	6	0.012	12	7.2	3.0	5	36	165	192	162	197	0.73
5	6	0.0038	3.8	8.9	2.1	14	38	201	226	193	233	0.80
6	6	0.21	2.1e+02	3.3	2.9	10	28	226	243	221	244	0.70

Coding Sequence: ATGAATGATGCCACCGAGAACATCATATTAGGCCTCGATTTTCTCCAGAAGGTGAACACCACCCTAGTTTGTACCGGCCTGGTCGTAAGATTAGAACAGAAGGGGAAGCCCGAGAGACAGGAGGAAACCAATGACAAGGTAAGAGAACCACACAGTGAACCAATGTACGCAGTACGCAGCGAATTGAGCCGCAGCCTGAAACAGAAAATAGACCGCTTTCTTAGCAAAGAACACTATGTCAATCACTATATGTGGCATACTGGTCAAACTCCACATCAATGTGAAGTATGTGGCAAAAAGTATACACGCAAAGAACATTTAACAAATCATATGCGTTCGCACACAAATGACACACCGTTTCGTTGCGAAATTTGTGGTGAAAGCTATAGTCGTAAGGAGCATTTTACTAATCATATATTATGGCATACACGGGAAACCCCACATCGTTGTGATTTCTGTTCGAAAACGTTTACACGCAAGGAACATTTATTAAATCATGTTCGCCAACATACTGGAGAATCGCCACATCGTTGTACATATTGTCTGAAAACTTTTACGCGAAAAGAGCATTTAGTAAATCATATACGACAATATACAGGTGAGACACCCTTTAAGTGCACTTACTGTACCAAGGCTTTCACCCGAAAAGATCACATGGTCAATCATGTACGCCAACATACAGGTGAATCTCCACATAAATGTACATACTGTACGAAGACGTTTAAGCACAAATAA
Protein Sequence: MNDATENIILGLDFLQKVNTTLVCTGLVVRLEQKGKPERQEETNDKVREPHSEPMYAVRSELSRSLKQKIDRFLSKEHYVNHYMWHTGQTPHQCEVCGKKYTRKEHLTNHMRSHTNDTPFRCEICGESYSRKEHFTNHILWHTRETPHRCDFCSKTFTRKEHLLNHVRQHTGESPHRCTYCLKTFTRKEHLVNHIRQYTGETPFKCTYCTKAFTRKDHMVNHVRQHTGESPHKCTYCTKTFKHK

Sequence clustering based on sequence similarity using MMseqs2