Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 2.7e-06 0.00042 19.6 0.1 2 41 10 48 9 52 0.93

2 6 2.4 3.7e+02 0.6 0.1 13 25 72 84 54 97 0.83

3 6 0.5 77 2.7 0.3 6 44 115 152 114 152 0.77

4 6 0.0058 0.91 8.9 0.2 16 44 187 215 178 215 0.89

5 6 3.3 5.2e+02 0.1 1.2 4 22 231 247 230 249 0.90

6 6 0.018 2.8 7.3 0.3 3 23 285 303 283 323 0.85

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	2.7e-06	0.00042	19.6	0.1	2	41	10	48	9	52	0.93
2	6	2.4	3.7e+02	0.6	0.1	13	25	72	84	54	97	0.83
3	6	0.5	77	2.7	0.3	6	44	115	152	114	152	0.77
4	6	0.0058	0.91	8.9	0.2	16	44	187	215	178	215	0.89
5	6	3.3	5.2e+02	0.1	1.2	4	22	231	247	230	249	0.90
6	6	0.018	2.8	7.3	0.3	3	23	285	303	283	323	0.85

Coding Sequence: ATGTCAGAATTTGTCTTAACCACAGTTAATGTgtttgattattttgaaagaattcCCGAAAACTACACTCAATTAAAGTGCAAGTCGTGCGGATCATATATTTCCTACTTTGGTTATCGAGGTTTTATAGCACATTTACGTTCAGTCAAACATtcagaatatttcaaaaaaacagCAAAGAAAAACTTAAAAGATAAACCGGATATATATTACGATAGAGAAAAGCGTGTATGTATCGTTTGTAGAAGAACTGTTTTGCCTGAAGAATTTGACAATCACATCCACAACTTACATTTTCCAGAACAAGTGGCACATTATGAACCGATCAGGACTAAAGAGGAACATATGACACGAATTAGTGAGTTTATGGTGATATGCGAACTGAACAAATGTAATAGAgatataaatcttgaaatagcACCAGCATTAAAGCTCCATTTAAGCAAAAAGCATTcgaacatattaaaaaatgtgcaaacgGGCGAAATGCATGGGCCAAGTATGGTCACAAATAAGAAAGAACTATTGAACAATTACACATTACACATGCCttattttcaagcaaaatgcAAGTTTTGCGAcaattttgtagaatattatatcaacATTGCAAAGTTTCGTCAACATTTAATAGGACATCATCCCGAAGTTAGTCGATACGAAGATGTTCCTAGAAACAAGGAATCCCCGTGGATACATTTCATGTATTATTCCGATACCAATGTACGATGTTATCGCTGCGATTATTTGCATACTGAGGTGATGGAAGAAGATTGGTTAAGAACACATATGGATATGTACCATAAGGAAGACGAAAACTCACCTTATTTTAACGAACACGTCAATGATTGGGCCTGGAAATACTGTGACACCATTGGAGAATTTCAAgtgcaatgtaaaatttgttccGTTGAAGAAGAACTTGATATTgaagtttcaaaattaaacgaCCATTTTGCAAATACACATCTGAACAAGCCACCAAgtagaaaaagagaatatgAAATAGCTGGACCGTCAGGAAGCCAATCAcaggagaaaaaaagtaaagaacaACgtTCATCGTAA
Protein Sequence: MSEFVLTTVNVFDYFERIPENYTQLKCKSCGSYISYFGYRGFIAHLRSVKHSEYFKKTAKKNLKDKPDIYYDREKRVCIVCRRTVLPEEFDNHIHNLHFPEQVAHYEPIRTKEEHMTRISEFMVICELNKCNRDINLEIAPALKLHLSKKHSNILKNVQTGEMHGPSMVTNKKELLNNYTLHMPYFQAKCKFCDNFVEYYINIAKFRQHLIGHHPEVSRYEDVPRNKESPWIHFMYYSDTNVRCYRCDYLHTEVMEEDWLRTHMDMYHKEDENSPYFNEHVNDWAWKYCDTIGEFQVQCKICSVEEELDIEVSKLNDHFANTHLNKPPSRKREYEIAGPSGSQSQEKKSKEQRSS

Sequence clustering based on sequence similarity using MMseqs2