Basic Information

Insect: Leucophora obtusa
Gene Symbol: -
Assembly: GCA_949987735.1
Location: OX465297.1:36483725-36484736[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 2.3 2.5e+02 4.2 0.0 2 23 11 32 10 32 0.92

2 8 0.00032 0.034 16.4 6.0 1 23 53 75 53 75 0.99

3 8 6e-05 0.0063 18.6 0.6 3 23 83 103 81 103 0.92

4 8 0.00061 0.065 15.5 1.4 2 23 110 131 109 131 0.97

5 8 0.00023 0.025 16.8 1.4 1 23 137 159 137 159 0.95

6 8 2.3e-05 0.0025 19.9 0.9 1 23 165 187 165 187 0.99

7 8 0.00089 0.095 14.9 2.9 1 23 193 215 193 215 0.98

8 8 0.0015 0.16 14.2 0.1 1 23 221 243 221 243 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	2.3	2.5e+02	4.2	0.0	2	23	11	32	10	32	0.92
2	8	0.00032	0.034	16.4	6.0	1	23	53	75	53	75	0.99
3	8	6e-05	0.0063	18.6	0.6	3	23	83	103	81	103	0.92
4	8	0.00061	0.065	15.5	1.4	2	23	110	131	109	131	0.97
5	8	0.00023	0.025	16.8	1.4	1	23	137	159	137	159	0.95
6	8	2.3e-05	0.0025	19.9	0.9	1	23	165	187	165	187	0.99
7	8	0.00089	0.095	14.9	2.9	1	23	193	215	193	215	0.98
8	8	0.0015	0.16	14.2	0.1	1	23	221	243	221	243	0.97

Sequence Information

Coding Sequence: ATGCCTTTACAAAATGAAGATGGTAGCATATCGTGCGAGGAATGTGAAGCTATATTGGAAAATGTTAGAAGATGGGAAGAACATATGCGTGAACATCGTCTTGGAAAACTACCGAAGAgaaaaaatatgaagaaaacTAAAAAGCCATTAAAGACGTATAAATGCGAACACTGTAATAAAGaatTTAATAGATTAGTTTGCTATAGAAATCATGAGCGCATACATACAGGTGAAGAACCTTTTCTATGTATTGAGTGTGGTAAAAGTTTTAAAGCTTTAAGTAGTTTAAATACACACATGTTGCGACATAAAGGTGTAAAAAATATACAATGTCCTCACTGTCCGAAGAAATTTGTATGTTCAAGTGGCTTGTACGGTCATATGATGGTACATACTAAGGAAAAACCATTTGTCTGCGATATTTGTGGACAATCCTTTCATATGGCATATATGCTAAGAAAACATAATCTATATCATAATAACATTCGCAATTATCCGTGTGAATATTGTGATATGCGGTTTGTTACAGGCGAAAAACAGCGGCGTCACATGCGTACACATACGGGTGAAAAACCATATAGTTGTAAATATTGCGAGCGAGCTTTTGCACAAAGTAATGATTGTATTAAACATTTGCGACAACATCTTGGCGATAATGTTTATCAATGTGAATTGTGTCCCTTGCGATATCCCAAGGCTAGAGATTTGCGGGTACATTTTGCCAGCCATAAGGATGATGACGAAGAAACTCGTACTCGCAATTTAGAAGCGCGTATGAAGGAGGAAAgaaacttaaaaataaaatttggtgtgccagatatttga
Protein Sequence: MPLQNEDGSISCEECEAILENVRRWEEHMREHRLGKLPKRKNMKKTKKPLKTYKCEHCNKEFNRLVCYRNHERIHTGEEPFLCIECGKSFKALSSLNTHMLRHKGVKNIQCPHCPKKFVCSSGLYGHMMVHTKEKPFVCDICGQSFHMAYMLRKHNLYHNNIRNYPCEYCDMRFVTGEKQRRHMRTHTGEKPYSCKYCERAFAQSNDCIKHLRQHLGDNVYQCELCPLRYPKARDLRVHFASHKDDDEETRTRNLEARMKEERNLKIKFGVPDI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00893187; iTF_00717069;
90% Identity: iTF_00893187; iTF_00717069;
80% Identity: -