Basic Information

Insect: Leucophenga varia
Gene Symbol: Kr-h1
Assembly: GCA_018903435.1
Location: JAEIFJ010001398.1:72699-74137[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.001 0.083 13.7 2.9 1 23 33 55 33 55 0.98

2 8 1.8e-05 0.0014 19.3 0.3 3 23 85 105 85 105 0.99

3 8 6.6e-06 0.00052 20.6 2.3 1 23 111 133 111 133 0.98

4 8 1.4e-07 1.1e-05 25.9 2.8 1 23 139 161 139 161 0.99

5 8 1e-07 8.3e-06 26.3 1.3 1 23 167 189 167 189 0.98

6 8 4.1e-05 0.0033 18.1 1.5 1 23 195 219 195 219 0.99

7 8 0.19 15 6.6 3.7 1 23 225 247 225 247 0.94

8 8 3.9e-07 3.1e-05 24.5 0.5 1 23 253 275 253 275 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.001	0.083	13.7	2.9	1	23	33	55	33	55	0.98
2	8	1.8e-05	0.0014	19.3	0.3	3	23	85	105	85	105	0.99
3	8	6.6e-06	0.00052	20.6	2.3	1	23	111	133	111	133	0.98
4	8	1.4e-07	1.1e-05	25.9	2.8	1	23	139	161	139	161	0.99
5	8	1e-07	8.3e-06	26.3	1.3	1	23	167	189	167	189	0.98
6	8	4.1e-05	0.0033	18.1	1.5	1	23	195	219	195	219	0.99
7	8	0.19	15	6.6	3.7	1	23	225	247	225	247	0.94
8	8	3.9e-07	3.1e-05	24.5	0.5	1	23	253	275	253	275	0.98

Sequence Information

Coding Sequence: ATGGTTAGCACAACAATATCAAATACACCTGCTACAACAACAACAACGACAACAAAATCCACACCCGGCCGTAAACCAAATCCAAATAAGCCACAGTTTAAATGTGAACAATGTGGCATGAGTTTCGGTAGTAAATCAGCGCATACATCGCATACCAAATCGCATGCTAAGAGTACGGATGTCAGCATGAATGGTGGCGTACCAAGCACATCCAGCAATAGCAACGGCAATACAGGAGCAGCAAATGTTGGCTGTAATGTCTGTCAGAAGACATTTGCTGTACCCGCAAGACTGATTCGCCATTATCGCACGCACACCGGTGAGCGTCCATTCGAGTGTGAATTCTGTCACAAACTGTTCAGCGTTAAGGAGAATTTACAGGTGCATCGACGCATACACACAAAGGAACGTCCGTATAAGTGTGATGTCTGCGGTCGCGCTTTTGAACACTCCGGCAAGCTGCATCGTCACATGCGCATACACACCGGCGAGCGTCCACATAAATGTTCGGTTTGTGAGAAAACTTTTATACAATCAGGACAGCTGGTCATACACATGCGTACACATACCGGCGAGAAACCATATAAATGCCCGGTAGAGGGTTGTGGCAAAGGATTCACATGCTCCAAACAACTTAAAGTGCACTCACGTACACATACTGGCGAGAAACCATACCATTGTGACATCTGTTTCCGTGACTTTGGTTACAATCATGTTTTAAAATTGCATCGTGTGCAGCATTATGGTTCCAAGTGCTACAAGTGTACCATATGCGATGAGACATTTAAGAGTAAGAAAGAGATGGAAGCGCACATAAAAGGACATGCCAATGAAATACCCGATGATGAAGATGCTGCAGCAGCAACTGCTGGAGCTGGCTACTAA
Protein Sequence: MVSTTISNTPATTTTTTTKSTPGRKPNPNKPQFKCEQCGMSFGSKSAHTSHTKSHAKSTDVSMNGGVPSTSSNSNGNTGAANVGCNVCQKTFAVPARLIRHYRTHTGERPFECEFCHKLFSVKENLQVHRRIHTKERPYKCDVCGRAFEHSGKLHRHMRIHTGERPHKCSVCEKTFIQSGQLVIHMRTHTGEKPYKCPVEGCGKGFTCSKQLKVHSRTHTGEKPYHCDICFRDFGYNHVLKLHRVQHYGSKCYKCTICDETFKSKKEMEAHIKGHANEIPDDEDAAAATAGAGY

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -