Basic Information

Transcription Factor Domain

TF Family: TEA
Domain: TEA domain
PFAM: PF01285
TF Group: Helix-turn-helix
Description: The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and AbaA. The TEA domain is located toward the N terminus of eukaryotic transcription factors of the TEA/ATTS family. It shows a three-helix bundle with a homeodomain fold [3, 1]. Two α-helices are nearly anti-parallel and pack on either side of the third one, which is the DNA-recognition helix of the TEA domain. Phosphorylation of one or both of the two conserved serines found on the DNA-binding surface could interfere with DNA-binding activity, by introducing electrostatic repulsion and/or steric hindrance, and help regulate the transcription factor activity of the proteins [2, 1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 7e-19 2e-14 55.2 1.7 24 66 13 55 4 57 0.83

2 2 0.092 2.6e+03 0.4 0.0 24 59 120 155 109 163 0.77

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	7e-19	2e-14	55.2	1.7	24	66	13	55	4	57	0.83
2	2	0.092	2.6e+03	0.4	0.0	24	59	120	155	109	163	0.77

Coding Sequence: ATGAAAAATAAAACGAAATCTCCCGGAGACCGCAAAAAAAAGAAGAAATCTCCGGTGACAGAATTGGCGAAGGGTCGCAATGAGTTGATCGCACGTTACATCAAACTAAGGACCGGTAAGACGAGAACGCGAAAGCAAGTCTCGTCTCACATACAGGTCCTTGCTAGGAGGAAACTTCGAGAAATCCAGGCTAAACTCAAAGTGCGAATAGCGAACAATTGGGCTGGGTTAATAAATCAAAGCACGGTTTTCGTTGAGTCGAGTGGACAGTGGTGTGTGCGTTTACATTTGCCGCCGTTTGGTCAGCATTCGAGAGGGATTAAGCTCCGCCTACTGCATGTCGTCGCTCCCACTCTGCAACTGACACTCCGCCTCGAGCGCACGAGAGCGAAAGAGAAGTCAACGCTTCTCTCGCTCGCTCTCGTTACCCCCACTTCCAGGGGACGCTCGAGGCGGAGCGTAAGCGCCGGAGTGGGGACAATGAGAGCGAGAGAGAAGTCCTCTTTCTTCTCGCTCGCTCCCATTGCCCCACTCTTGCGCTTACGCTCCGCCTCCTTCGCCCGCTGGAGTGGTGGTAACGAGAGCGACAAAGAAACCTAG
Protein Sequence: MKNKTKSPGDRKKKKKSPVTELAKGRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKLREIQAKLKVRIANNWAGLINQSTVFVESSGQWCVRLHLPPFGQHSRGIKLRLLHVVAPTLQLTLRLERTRAKEKSTLLSLALVTPTSRGRSRRSVSAGVGTMRAREKSSFFSLAPIAPLLRLRSASFARWSGGNESDKET

Sequence clustering based on sequence similarity using MMseqs2