Basic Information

Insect: Leptopilina boulardi
Gene Symbol: -
Assembly: GCA_011634795.1
Location: PHTE01002290.1:13822-14796[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 2.1e-07 2.2e-05 25.0 2.6 1 23 119 141 119 141 0.99

2 7 0.00028 0.03 15.2 4.2 1 23 147 170 147 170 0.97

3 7 0.0002 0.022 15.6 4.8 1 23 176 198 176 198 0.97

4 7 2.4e-07 2.6e-05 24.8 1.4 1 23 204 226 204 226 0.98

5 7 0.29 31 5.7 6.7 1 23 232 254 232 254 0.97

6 7 2.5e-06 0.00027 21.6 0.7 1 23 260 282 260 282 0.97

7 7 5.2e-05 0.0056 17.5 1.8 1 23 288 311 288 311 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	2.1e-07	2.2e-05	25.0	2.6	1	23	119	141	119	141	0.99
2	7	0.00028	0.03	15.2	4.2	1	23	147	170	147	170	0.97
3	7	0.0002	0.022	15.6	4.8	1	23	176	198	176	198	0.97
4	7	2.4e-07	2.6e-05	24.8	1.4	1	23	204	226	204	226	0.98
5	7	0.29	31	5.7	6.7	1	23	232	254	232	254	0.97
6	7	2.5e-06	0.00027	21.6	0.7	1	23	260	282	260	282	0.97
7	7	5.2e-05	0.0056	17.5	1.8	1	23	288	311	288	311	0.98

Sequence Information

Coding Sequence: ATGattgaaacaaattcaaaaagatCTTCAccgaaatttgaatattatatgaaaaaatgcgCTTCAATTATTCGTGTATCcgataagaaaaaattgaaaatttctccacaaaagaaaattattgaaacaaaaaaaaattccaaaacacaaaattctttacaaaaaaaatctccaaataatttgaaaaatactaattttcaaattaaaaaaaattccgtcaattcaaaaaataatgaaatattgaatgataataaattaaaaaataatgaaatttccaCTAACAACACTACTCAAGTTTCATTggaaaaatcgattataaaaaaagaaaaattatcgacaattaatgaaaaatcatttgaatgtgacaaatgtgataaaaaatataaattaaatgacaatttaaaaaatcatcaacgtactcattcaaatgaaaaaacataCACATGTCATATTTGTggtaaacaatttcaattgagAGGAAGtctttattatcatttaagaCATGTGCATGGCGGTGTTAAAAATCATTCATGCGATATTTGTGGACGTTGTTTTGCAATGAAAACAACATTGGAAGATCATCGACATATTCATACGGGTGAACGTCCATATGTTTGTGATACATGtggaaaaacatttaaatcaaaagcATCACTTTATATTCATCGTAAAAGTCATACAAATGATTATCCACataaatgttgttattgtaaaCGGGGATTTAGATGGAAACAACAAATGATGGATCATTTAACGACTCATACGGGAGTCAAAAATCATGTCTGTGATATTTGCAGTAAGGCGTTTGGCGTAAAAAAGGAATTGACAAGacacattaaaattcattcggAGGAAAAGCCATATTCTTGTCTTCAGTGTGGTTTGAATTTTGGTCAAAaacgttatttaaaaaatcatgagcgcactaaacataaaaataatgatgatgatgttgaTGGGAGCAGCGTTAAATAA
Protein Sequence: MIETNSKRSSPKFEYYMKKCASIIRVSDKKKLKISPQKKIIETKKNSKTQNSLQKKSPNNLKNTNFQIKKNSVNSKNNEILNDNKLKNNEISTNNTTQVSLEKSIIKKEKLSTINEKSFECDKCDKKYKLNDNLKNHQRTHSNEKTYTCHICGKQFQLRGSLYYHLRHVHGGVKNHSCDICGRCFAMKTTLEDHRHIHTGERPYVCDTCGKTFKSKASLYIHRKSHTNDYPHKCCYCKRGFRWKQQMMDHLTTHTGVKNHVCDICSKAFGVKKELTRHIKIHSEEKPYSCLQCGLNFGQKRYLKNHERTKHKNNDDDVDGSSVK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00879971;
90% Identity: iTF_00879971;
80% Identity: iTF_00879971;