Basic Information

Transcription Factor Domain

TF Family: AP-2
Domain: TF_AP-2 domain
PFAM: PF03299
TF Group: Basic Domians group
Description: Activator protein-2 (AP-2) transcription factors constitute a family of closely related and evolutionarily conserved proteins that bind to the DNA consensus sequence GCCNNNGGC and stimulate target gene transcription [PMID: 2010091, PMID: 1998122]. Four different isoforms of AP-2 have been identified in mammals, termed AP-2 alpha, beta, gamma and delta. Each family member shares a common structure, possessing a proline/glutamine-rich domain in the N-terminal region, which is responsible for transcriptional activation [PMID: 2010091], and a helix-span-helix domain in the C-terminal region, which mediates dimerisation and site-specific DNA binding [PMID: 199812]. http://www.ebi.ac.uk/interpro/entry/IPR013854
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 5.3e-45 1.2e-40 140.8 0.2 1 84 22 105 22 105 1.00

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	5.3e-45	1.2e-40	140.8	0.2	1	84	22	105	22	105	1.00

Coding Sequence: aTGAAACCATCGGATCGAGGTGAAAAAGCAATGCTATCTGGTAACGCCCAGCCATCAGATGTTTTTTGCTCGGTGCCAGGTAGGCTATCGTTGTTAAGCAGTACAAGCAAATACAAAGTCACAGTTGCTGAAGTACAACGACGGTTATCACCACCTGAATGCCTAAACGCGAGTCTTCTTGGTGGAGTTTTACGAAGggcAAAGTCTAAAAACGGTGGTCGACTTCTGAGGGAGAAACTCGAAAAAATCGGACTCAATCTACCCGCCGGAAGGAGGAAGGCTGCCAACGTCACATTATTAACGTCTTTAGTCGAAG
Protein Sequence: MKPSDRGEKAMLSGNAQPSDVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRLLREKLEKIGLNLPAGRRKAANVTLLTSLVE

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01266591;
90% Identity: iTF_00050498; iTF_01421922; iTF_00129415; iTF_00286887; iTF_00867080; iTF_00868456; iTF_00128651; iTF_00125596; iTF_00127868; iTF_00127135; iTF_01213007; iTF_01411988; iTF_00881687; iTF_00718206; iTF_00939198;
80% Identity: -