Basic Information

Insect: Leptidea sinapis
Gene Symbol: -
Assembly: GCA_905404315.1
Location: FR990176.1:3855132-3865880[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.00047 0.064 14.9 1.6 1 23 30 52 30 52 0.99

2 10 0.027 3.6 9.3 4.4 1 23 56 79 56 79 0.96

3 10 0.16 21 6.9 6.0 1 23 86 108 86 108 0.98

4 10 3.9e-06 0.00053 21.4 1.3 2 23 113 135 112 135 0.96

5 10 0.00077 0.1 14.2 0.4 1 23 142 165 142 165 0.94

6 10 0.00064 0.087 14.4 0.9 1 21 170 190 170 194 0.94

7 10 2.1e-05 0.0028 19.1 0.5 1 23 203 226 203 226 0.94

8 10 1.7e-05 0.0023 19.4 3.7 1 23 232 255 232 255 0.95

9 10 4.6e-05 0.0062 18.1 0.5 3 23 266 286 265 286 0.98

10 10 0.0079 1.1 11.0 0.6 2 23 293 315 292 315 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.00047	0.064	14.9	1.6	1	23	30	52	30	52	0.99
2	10	0.027	3.6	9.3	4.4	1	23	56	79	56	79	0.96
3	10	0.16	21	6.9	6.0	1	23	86	108	86	108	0.98
4	10	3.9e-06	0.00053	21.4	1.3	2	23	113	135	112	135	0.96
5	10	0.00077	0.1	14.2	0.4	1	23	142	165	142	165	0.94
6	10	0.00064	0.087	14.4	0.9	1	21	170	190	170	194	0.94
7	10	2.1e-05	0.0028	19.1	0.5	1	23	203	226	203	226	0.94
8	10	1.7e-05	0.0023	19.4	3.7	1	23	232	255	232	255	0.95
9	10	4.6e-05	0.0062	18.1	0.5	3	23	266	286	265	286	0.98
10	10	0.0079	1.1	11.0	0.6	2	23	293	315	292	315	0.95

Sequence Information

Coding Sequence: ATGGCAAGTGGTAAAGCAACCTCTGCTGAACATCTGCAACAGCAGGagccaagagatgcgttgccggcaaTGAAATTCGAGAACTGTTACCAGTGCGAAATTTGCAAATCAGTATTGAGAACGGAAGAGTCATACAAACAGCATTATCGGAGACATTTCACCAGATACGATTGCAGGGAATGTAAAAAACGGTATAAAACATTGCACGCCGTCCTCGACCATCACAATAAAGAACATGGCGGCTCGGAGATACGCTTCGAATGTGATCTTTGTGATTTCACAAGTTGCTCAAATCGTCGATATCGGTATCACCGAAAAACACATGAACTGAAGATTGAATGTAAGATCTGCCACAAAGTGTTCagcacgatatccgtattgcgcCAACATATACGTAATACGCATGAGAAGAAGAAACGCACATATGCTTGCAACGAGTGCGGCGAAACTTTTCCCAAACCCACCGGCGTGTACCATCATAAGCAGAACGCACACAAACGAGACGTGTTTTACTGCGATAAGTGCGACATCTATTTCAAAACGAAGGCAACGTTGGCCACTCACTTCAAACAGAGCTCCAACCATATCACGGCGGAGGACATGAAATTCATATGCTCTACGTGTGGCAAAGGATTTTTCAAGAAATCTTTACTGGAGGTTCATATTACTTAcgatcatttaaatattatcaaacaCAAATGTGATCTTTGTTCGAAGaCTTATAAATCCGCTGCGAATTTGAAGCGACATAAAAAGTTAACCCACGAGAAAGTAAGATTGCCGAAGAACAAAATATGTGATCACTGTGGCGCGGGGTTTACTACTCAAGCAATCCTCCGGACTCACATTCGTACACACACCGGCGAGCGACCGCTGCGGTGCGAACACTGCGCGGCTGACTTCGCGCACCCTGGTGCGTTGTACACCCACAAGAGACTAGTCCATAAACTAGATGAGAAAACCTGA
Protein Sequence: MASGKATSAEHLQQQEPRDALPAMKFENCYQCEICKSVLRTEESYKQHYRRHFTRYDCRECKKRYKTLHAVLDHHNKEHGGSEIRFECDLCDFTSCSNRRYRYHRKTHELKIECKICHKVFSTISVLRQHIRNTHEKKKRTYACNECGETFPKPTGVYHHKQNAHKRDVFYCDKCDIYFKTKATLATHFKQSSNHITAEDMKFICSTCGKGFFKKSLLEVHITYDHLNIIKHKCDLCSKTYKSAANLKRHKKLTHEKVRLPKNKICDHCGAGFTTQAILRTHIRTHTGERPLRCEHCAADFAHPGALYTHKRLVHKLDEKT*

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00874737;
90% Identity: iTF_00874737;
80% Identity: -