Basic Information

Insect: Lasioglossum zephyrum
Gene Symbol: ZFX
Assembly: GCA_028455615.1
Location: CM052322.1:7143438-7144448[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00011 0.0092 16.6 1.8 1 23 38 60 38 60 0.97

2 9 0.0022 0.19 12.4 0.9 2 23 86 108 85 108 0.92

3 9 0.0016 0.14 12.9 1.4 1 23 122 145 122 145 0.91

4 9 1.1e-06 9.6e-05 22.8 0.5 1 23 151 174 151 174 0.96

5 9 0.00027 0.023 15.3 5.6 2 23 180 202 179 202 0.95

6 9 4.6e-05 0.004 17.7 0.7 1 23 207 230 207 230 0.97

7 9 3.9e-06 0.00034 21.1 4.7 2 23 237 258 236 258 0.96

8 9 0.00011 0.0097 16.5 1.9 1 23 264 286 264 286 0.98

9 9 1.6e-05 0.0014 19.2 0.5 1 23 292 314 292 314 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00011	0.0092	16.6	1.8	1	23	38	60	38	60	0.97
2	9	0.0022	0.19	12.4	0.9	2	23	86	108	85	108	0.92
3	9	0.0016	0.14	12.9	1.4	1	23	122	145	122	145	0.91
4	9	1.1e-06	9.6e-05	22.8	0.5	1	23	151	174	151	174	0.96
5	9	0.00027	0.023	15.3	5.6	2	23	180	202	179	202	0.95
6	9	4.6e-05	0.004	17.7	0.7	1	23	207	230	207	230	0.97
7	9	3.9e-06	0.00034	21.1	4.7	2	23	237	258	236	258	0.96
8	9	0.00011	0.0097	16.5	1.9	1	23	264	286	264	286	0.98
9	9	1.6e-05	0.0014	19.2	0.5	1	23	292	314	292	314	0.97

Sequence Information

Coding Sequence: ATGCAACCTTGGAGCCCTAATAAACGCGAGATTCTTTCCTGTTTTAGGCAGAGCCCAGTATCCATGCTCCCCGAGGACTTGAAAGTGATACGAAAAGAAGATTCTGACTCGTTCAGCTGCGACGTTTGCGAGAAACAGTTCAAAAGGAAGTACATCCTACAACGACACAAGCTGATACACGAAAATCAGGAGAAGAAGCTGTCCACCGAAGACTCTTTGACTGTGAAGTTACCCTGTCCGAAGCAGGAACCTCTGTCTTGCTTGATCTGCGACTTCCGTTGCAGTAGAAGATCCAGCATGATCGCTCATCTAGCTCAGGACCACGACGGATCCGAGAAGAGCAAGTCCACCAACGAATTGAAATTCGCCTGTGTAATCTGCGGGCTGATTTGCTCGCGCaaggagacgctgagatctcatttcgtgcgcaagcatacgcaacacttcgagttcccttgcaaacagtgcggcaaggagttcaaggtgaagggtgacctgacgacgcacgttcggctgaatcatcaggagcccccggtgatgtgcgacgtatgcggaaagacctgtcgcaacagccatagtctgtacacccatcagaagcacgctcattacaaagcgaagttcgagtgtccggtctgccacaggcgactggtcaccaaggagaacctggaccagcacgttctcacccagcacgagaagaaggagaagtgcgtgtgcgaggagtgcggcaagaccttcttcgagaaccacgacttcagaaaacacatgcgaatacacactggggacaagccgtacaaatgcacggtctgcgccagggctttcaccactcacagcagtatgagccagcaccttcttctgcacacaggagagaggatctacgtctgcgacgtttgcggaaaatccttcgcccagaaggctggtctcatttgccataggaagatacattccggaaaactgccgcctctaccggtcatgcatatcgatcacatcttgaaggagttcATGAGCAAATGA
Protein Sequence: MQPWSPNKREILSCFRQSPVSMLPEDLKVIRKEDSDSFSCDVCEKQFKRKYILQRHKLIHENQEKKLSTEDSLTVKLPCPKQEPLSCLICDFRCSRRSSMIAHLAQDHDGSEKSKSTNELKFACVICGLICSRKETLRSHFVRKHTQHFEFPCKQCGKEFKVKGDLTTHVRLNHQEPPVMCDVCGKTCRNSHSLYTHQKHAHYKAKFECPVCHRRLVTKENLDQHVLTQHEKKEKCVCEECGKTFFENHDFRKHMRIHTGDKPYKCTVCARAFTTHSSMSQHLLLHTGERIYVCDVCGKSFAQKAGLICHRKIHSGKLPPLPVMHIDHILKEFMSK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00864811;
90% Identity: iTF_00864811;
80% Identity: -