Lmal008129.1
Basic Information
- Insect
- Lasioglossum malachurum
- Gene Symbol
- -
- Assembly
- GCA_028455605.1
- Location
- CM052312.1:8848822-8850234[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 9 8.4e-06 0.00063 20.1 3.7 2 23 105 126 104 126 0.97 2 9 0.00023 0.017 15.6 1.0 1 23 128 151 128 151 0.95 3 9 0.0012 0.091 13.3 0.9 1 23 156 179 156 179 0.96 4 9 6.5e-05 0.0048 17.3 1.6 1 23 185 208 185 208 0.95 5 9 0.00052 0.038 14.5 2.0 2 23 215 237 214 237 0.95 6 9 0.0034 0.25 11.9 0.3 1 23 242 264 242 264 0.96 7 9 0.00031 0.023 15.2 0.5 3 23 272 291 271 291 0.98 8 9 2.5e-06 0.00018 21.8 0.1 1 23 297 319 297 319 0.97 9 9 0.00042 0.031 14.8 0.4 1 23 325 347 325 347 0.97
Sequence Information
- Coding Sequence
- ATGTTAAAACCAGTTGAATCGCTGTCAGGATCGGTCGATCTTGAGACCGATAGTTACGTCGGGGGACTGCGAGAGTTCCCGAGAGAACGAAAAGTATTAGAACACCCAGATAAGATCCTGGACCCCCTGAGCGAAGAGTACAAGAGCTACTCGGTCGCGAGCGTGGGATACACGGACTGGATCGACAAAGAGAACTTCGCGACGGTGATGGTGTGCCGAGAGGAGTACAACGGGGACAAGGCGACGGAACCATTGTGTTCGGCGAGTGGTGTCGATCGGCGAACAAAGAAGAGAGCGGTAACGAGCCGGCTGGAGTGCGACCACTGTCGCCGCAAGTTCTCGAAGAAGAGCAACCTCGCGGAGCACTTGAAGAAGCACCGGCACAGTTGCGCGGACTGCCCGAAGACGTTCCGGCTTCGTCGATACCTGGCCTCGcacgtcgagaagatccacagacaacaggtgtacgactgcagcgtgtgcgagtacaagagcaacaacaagggcacgctgaagaaccactacatacggctgcacacgagcaactacaacttcgcgtgcgacgtctgcgggaaacagttcaagatcaagaaagccctgaaccaccacgtcaaacagaaccacagcgacgcgccgccgatcgtctgcgacgtgtgcggacacttcagcaagaacctccacgcgctgaaggcccacatgaagtacaggcactacaagccggagttcatctgccggatctgccggagaggcatgaccacgcaggagaatctcgagcagcatctgacatggcacgagaccagggagaaggtactctgcccaacctgtggcaaaaggtttcggggtcgcgatctcgactctcacatgagggtgcacaccggggtaaaaccgttcccctgtccggtttgcgggaaatcgttccgcaggcagaccgcgcaggaacagcacgtcctcattcataccgggaagaggccgtacatttgcgatatttgcggacaggctttcgcgcagaaacccggattgatttgccataggaagagacaccccggaccactaccacctctacccgttgtgtccatcaagaacatagtgacggagttcaccaaggaatacactatgaaaaatACGATGATCAAAATCGAATAA
- Protein Sequence
- MLKPVESLSGSVDLETDSYVGGLREFPRERKVLEHPDKILDPLSEEYKSYSVASVGYTDWIDKENFATVMVCREEYNGDKATEPLCSASGVDRRTKKRAVTSRLECDHCRRKFSKKSNLAEHLKKHRHSCADCPKTFRLRRYLASHVEKIHRQQVYDCSVCEYKSNNKGTLKNHYIRLHTSNYNFACDVCGKQFKIKKALNHHVKQNHSDAPPIVCDVCGHFSKNLHALKAHMKYRHYKPEFICRICRRGMTTQENLEQHLTWHETREKVLCPTCGKRFRGRDLDSHMRVHTGVKPFPCPVCGKSFRRQTAQEQHVLIHTGKRPYICDICGQAFAQKPGLICHRKRHPGPLPPLPVVSIKNIVTEFTKEYTMKNTMIKIE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00360409;
- 90% Identity
- iTF_00866192;
- 80% Identity
- -