Lstr019162.1
Basic Information
- Insect
- Laodelphax striatellus
- Gene Symbol
- sd
- Assembly
- GCA_014465815.1
- Location
- CM025332.1:3975365-3977429[-]
Transcription Factor Domain
- TF Family
- TEA
- Domain
- TEA domain
- PFAM
- PF01285
- TF Group
- Helix-turn-helix
- Description
- The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and AbaA. The TEA domain is located toward the N terminus of eukaryotic transcription factors of the TEA/ATTS family. It shows a three-helix bundle with a homeodomain fold [3, 1]. Two α-helices are nearly anti-parallel and pack on either side of the third one, which is the DNA-recognition helix of the TEA domain. Phosphorylation of one or both of the two conserved serines found on the DNA-binding surface could interfere with DNA-binding activity, by introducing electrostatic repulsion and/or steric hindrance, and help regulate the transcription factor activity of the proteins [2, 1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 1.4e-17 2.1e-13 51.7 2.0 35 66 49 80 31 82 0.81
Sequence Information
- Coding Sequence
- ATGAAGAAGAAACAAGTTGACAAAAAAGAAGAAGGAGAATATGAGTTGGTTGCTGAAGGAGTAGAAGGAGTTGGAGGAGGAAGAGGAGGAGAAGTACTGAGACGGTGTTTGCAAAGCAGAAGTGGAAGACAGAAACTATGTGAAGAATGTCGCAACGAGCTGATAGCGAGGTACATAAAGCTGCGCACAGGCAAGACGCGAACACGGAAGCAAGTGAGCTCCCACATTCAGGTGCTCGCCAGGAGGAAACTACGAGAAATACAGGCAAAGTTGAAAGTGGTCAGTAACAGCATGTTTACACGGGGCATGTGGCCACCTAACCCACCCTCCTCATCCCTTCCTTTGCTCCTCATTGATGATCACTGGATCAAGAGCTGGAGAATGCTACTACTCTGA
- Protein Sequence
- MKKKQVDKKEEGEYELVAEGVEGVGGGRGGEVLRRCLQSRSGRQKLCEECRNELIARYIKLRTGKTRTRKQVSSHIQVLARRKLREIQAKLKVVSNSMFTRGMWPPNPPSSSLPLLLIDDHWIKSWRMLLL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -