Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.098 16 7.5 0.5 2 23 42 63 41 63 0.90

2 7 1.8 2.8e+02 3.5 0.1 2 20 90 108 89 112 0.77

3 7 0.0067 1.1 11.1 0.6 2 23 135 156 134 156 0.96

4 7 0.078 12 7.8 0.2 1 13 160 172 160 173 0.91

5 7 0.00015 0.023 16.3 1.3 1 23 187 210 187 210 0.95

6 7 0.026 4.1 9.3 0.8 2 23 218 240 217 240 0.91

7 7 9.9e-05 0.016 16.9 0.4 3 23 249 270 247 270 0.94

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.098	16	7.5	0.5	2	23	42	63	41	63	0.90
2	7	1.8	2.8e+02	3.5	0.1	2	20	90	108	89	112	0.77
3	7	0.0067	1.1	11.1	0.6	2	23	135	156	134	156	0.96
4	7	0.078	12	7.8	0.2	1	13	160	172	160	173	0.91
5	7	0.00015	0.023	16.3	1.3	1	23	187	210	187	210	0.95
6	7	0.026	4.1	9.3	0.8	2	23	218	240	217	240	0.91
7	7	9.9e-05	0.016	16.9	0.4	3	23	249	270	247	270	0.94

Coding Sequence: ATGGCGCCATTAGGTTTAGACCTCCGCAAGAGGAGCCATTTGGACGCGCACATGGACAACCTGAAGACGATCCTGGATAACTCCAACGCGTCACTGATCAAATGCCGGGGAAGCAAGGGCTTTGCCTGCTGCTGCTGCGACGCGCAATACCCCGATCCGGCGGATTTGAAAGAGCACACGCTTATCCACGACAATGTCTTCGAGTCTACCTACATAAAGAGCTTGGCGATACCGACTCTACTAATCAAGCTGGACATCACCGACCTCCAATGCAAAGTGTGCAGCAAACAGATACTAGAACTGGACGATCTAATAAAGCATCTGGTGGACGAACACGATGTTGAATACAACACCAAAATCAACAGCCATCTAGTTCCCTTCAGATTTGACAGTGAAGTCCTTCGTTGTGTATTTTGTAAGCAAATCTTCAACAACTTCAAAGTGCTCTTGGAACACATGAACGTTCACTATAGGAATTACGTCTGCGAAATCTGCGACACCGGCTTCGTGAATAGACGCATCTCTCAAATGCACGGCTATAGGCACCAGACCGGCGTCTACTATTGCACTTACTGCGGCAAGGAGTTCAATAATAGGATCAAGCAGAAGTCCCACGAGAGGGCGGTGCACGTGTTGTTGAACAAGCGAAGCAGGTGCGGGTTTTGTGGCGAGAGGTTCACGGATTACACTAAGAAGAACGAGCACGAAATTAAAGAGCACGGTGCGAAGCCGGTCGTGCTGATTTGCTACGCGTGCGAGAAGACGTTCGAAAATCAGCGCGCTTTGACACTGCATATAAAGACTTTTCACCTGATGGAACGCTAG
Protein Sequence: MAPLGLDLRKRSHLDAHMDNLKTILDNSNASLIKCRGSKGFACCCCDAQYPDPADLKEHTLIHDNVFESTYIKSLAIPTLLIKLDITDLQCKVCSKQILELDDLIKHLVDEHDVEYNTKINSHLVPFRFDSEVLRCVFCKQIFNNFKVLLEHMNVHYRNYVCEICDTGFVNRRISQMHGYRHQTGVYYCTYCGKEFNNRIKQKSHERAVHVLLNKRSRCGFCGERFTDYTKKNEHEIKEHGAKPVVLICYACEKTFENQRALTLHIKTFHLMER

Sequence clustering based on sequence similarity using MMseqs2