Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010001223.1:1823120-1824813[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 13 0.041 0.57 10.9 0.3 1 22 68 89 68 89 0.96

2 13 0.13 1.8 9.3 0.3 1 21 148 168 148 169 0.94

3 13 0.017 0.24 12.0 1.7 1 23 175 197 175 197 0.98

4 13 0.011 0.16 12.6 3.3 1 21 202 222 202 224 0.95

5 13 0.00028 0.004 17.6 2.1 1 23 229 251 229 251 0.99

6 13 0.0041 0.058 14.0 4.2 1 23 283 305 283 305 0.98

7 13 0.016 0.22 12.1 2.8 1 23 310 332 310 332 0.99

8 13 0.0082 0.12 13.0 1.0 1 23 337 359 337 359 0.99

9 13 0.0018 0.025 15.1 3.5 1 23 364 386 364 386 0.98

10 13 4.2 60 4.5 5.4 1 21 391 411 391 413 0.94

11 13 4 57 4.6 2.4 1 23 418 440 418 440 0.92

12 13 2.5 35 5.2 3.6 1 21 445 465 445 467 0.92

13 13 0.0009 0.013 16.1 1.8 1 23 499 521 499 521 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	13	0.041	0.57	10.9	0.3	1	22	68	89	68	89	0.96
2	13	0.13	1.8	9.3	0.3	1	21	148	168	148	169	0.94
3	13	0.017	0.24	12.0	1.7	1	23	175	197	175	197	0.98
4	13	0.011	0.16	12.6	3.3	1	21	202	222	202	224	0.95
5	13	0.00028	0.004	17.6	2.1	1	23	229	251	229	251	0.99
6	13	0.0041	0.058	14.0	4.2	1	23	283	305	283	305	0.98
7	13	0.016	0.22	12.1	2.8	1	23	310	332	310	332	0.99
8	13	0.0082	0.12	13.0	1.0	1	23	337	359	337	359	0.99
9	13	0.0018	0.025	15.1	3.5	1	23	364	386	364	386	0.98
10	13	4.2	60	4.5	5.4	1	21	391	411	391	413	0.94
11	13	4	57	4.6	2.4	1	23	418	440	418	440	0.92
12	13	2.5	35	5.2	3.6	1	21	445	465	445	467	0.92
13	13	0.0009	0.013	16.1	1.8	1	23	499	521	499	521	0.98

Sequence Information

Coding Sequence: ATGGACGTCGCATATAACGAAAGTTGTCAAATAAAATCAGAGGTGATTGTAAGTGAAACATTTTCATATTgtggaaaatatgaagataatgaaaataaagaattgaaatcaGAGCCAGTAGATTTTGAAAAACCTTTTAAATGTGAAGTGGAGGATAATTTTGCGGAGCACATTGATATATGTGGTGTACCCATAtatcaatatatttgtaatgaatgtaattttattacaacaaagaAAGATTTTCtaatagaacatttgaaaactaCTGAAAacgttcaatatttttgtaaagtatgTGAATTTAACACCTCGTTGAGATGTTCGATAAGAGAGCATTCCAGGATACATAACAAGGTTGAGTGTggacatattattaaaaaatgtaactttaagAAACCACGACTTTTCTCTTTAGCAACTCAAAAGAGTGGCGATGAATAtagttgtaaagaatgtgattataacaCACTGAGGAAAGAggatctaaaggaacatgtaaaaattggtactggtaataaatataagtgtaaggagtgtgattataaaacaagatggaaacagagtctaaaggaacatgtaaaaattcatactggtgacgaatataagtgtaaggaatgtgattatagaacaATACGGAAACAGACCCTAATTGATCACATAAAAtgtcatactggtgatgaatataagtgtaaggaatgtgactttaaaacagtgaggaaacaGAGGTTAAAtgaacatatgagaattcatactggtgatgaatataagtgtaacaactgtatttataaaacaccatggaaacagagATTAAGAGAACATGTGAAAACTCATACTGATGATCAATACaggtgtaaggaatgtgattatagaacagTACGGAAACATTGTCTAATTGAACACATAACAATTCATGGtgatgataaatataagtgtaaggaatgtgattataaaacaaagtggAAACGGAGTCTCAAAGTACATGAAAAAACTCATAACGATGATGAATACaaatgtacagaatgtgattataaaacagtatggaaacggagtctaaaagaacatataaaaattcataatggtgatgaacataagtgtaaggaatgtgactataaaaccgTGAGAAAAAGTagactaaaggaacatgtgaaaattcatactgatggtgaatataaatgtaaggaatgcgattttaaaacagtatggaaacataatctaaaagaacatgtaaaatgtcatactggtgatgaatttaATTGtacggaatgtgattataaaacactatggaaacagagtctaaaagaacatatgaaaattcatactgatgatgaatacaagtgtaaggaatgtgattataaaacaccctgGAAACGtagtctaaaagaacatgtaaaatgtcataccggtgatgaatataggtgtaatgaatgtaactataaaacatgGTGGGAACGAAGTCTAAACGAACATATAAAAACTCATACTGATGCTAAATACAACTGtatggaatgtgattataaaacagtacgaaaatggagtctaaagaaacatgtaaaACGTCATACTGGtgtaagtgtaaggaatgtgactataaaacagtatagggaacttaatttaaaaatatgtgggAATTCATATGACTGA
Protein Sequence: MDVAYNESCQIKSEVIVSETFSYCGKYEDNENKELKSEPVDFEKPFKCEVEDNFAEHIDICGVPIYQYICNECNFITTKKDFLIEHLKTTENVQYFCKVCEFNTSLRCSIREHSRIHNKVECGHIIKKCNFKKPRLFSLATQKSGDEYSCKECDYNTLRKEDLKEHVKIGTGNKYKCKECDYKTRWKQSLKEHVKIHTGDEYKCKECDYRTIRKQTLIDHIKCHTGDEYKCKECDFKTVRKQRLNEHMRIHTGDEYKCNNCIYKTPWKQRLREHVKTHTDDQYRCKECDYRTVRKHCLIEHITIHGDDKYKCKECDYKTKWKRSLKVHEKTHNDDEYKCTECDYKTVWKRSLKEHIKIHNGDEHKCKECDYKTVRKSRLKEHVKIHTDGEYKCKECDFKTVWKHNLKEHVKCHTGDEFNCTECDYKTLWKQSLKEHMKIHTDDEYKCKECDYKTPWKRSLKEHVKCHTGDEYRCNECNYKTWWERSLNEHIKTHTDAKYNCMECDYKTVRKWSLKKHVKRHTGVSVRNVTIKQYRELNLKICGNSYD

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -