Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010001323.1:2275054-2276018[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00035 0.005 17.3 1.2 1 23 62 84 62 84 0.98

2 9 0.00034 0.0048 17.4 1.1 1 23 89 111 89 111 0.99

3 9 0.33 4.6 8.0 3.6 1 23 116 138 116 138 0.97

4 9 0.0038 0.054 14.1 1.2 1 23 143 165 143 165 0.98

5 9 1.5 21 6.0 0.8 1 23 170 192 170 192 0.92

6 9 0.01 0.15 12.7 0.9 1 23 197 219 197 219 0.98

7 9 0.0026 0.037 14.6 2.8 1 23 224 246 224 246 0.98

8 9 0.92 13 6.6 1.2 1 23 251 273 251 273 0.96

9 9 0.0011 0.015 15.8 1.0 1 23 278 300 278 300 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00035	0.005	17.3	1.2	1	23	62	84	62	84	0.98
2	9	0.00034	0.0048	17.4	1.1	1	23	89	111	89	111	0.99
3	9	0.33	4.6	8.0	3.6	1	23	116	138	116	138	0.97
4	9	0.0038	0.054	14.1	1.2	1	23	143	165	143	165	0.98
5	9	1.5	21	6.0	0.8	1	23	170	192	170	192	0.92
6	9	0.01	0.15	12.7	0.9	1	23	197	219	197	219	0.98
7	9	0.0026	0.037	14.6	2.8	1	23	224	246	224	246	0.98
8	9	0.92	13	6.6	1.2	1	23	251	273	251	273	0.96
9	9	0.0011	0.015	15.8	1.0	1	23	278	300	278	300	0.99

Sequence Information

Coding Sequence: ATGGATGTTGATGCTATTGAACATTGTGCAATAAAACCCGaaataattttaacagaaacattttcgtTCTGCGGAAAATACGGAGATTGTAGTAGTGAAGAACTGAAAACAGAGCCAGTGGATTACAAAGAATCAATTAAATTCAAGGCAGATGTTCATGCAGAGCACATAGAAACatgtgaatataagtgtgaagaatgtgattataaaacattgcggaaaagtaatctaaaggagcatgtcaaaattcatacaggtgatgaatataaatgtaaagaatgtgattataaatcagtgtggaaaagtaatctaaagaatcatgtcagaattcatacaggtaataaatataagtgtacagaatgcgattataaaacattgtggaaaaataatctaaagaatcatattaaaattcatacgggcgacgaatataaatgtgaagaatgtgattataaaacagtatggaaatctCATTTAatggaacatgtgaaaattcatagaggtgatgaatataagtgtgaggaatgtgaatataaaacattgcggaaaaatattttaaaggaacacgtcaaaattcatacaggtgatgaatataagtgtaaagaatgcaattataaaacagtgtggataAATAATCTAAAGaatcatatcaaaattcatacaggtgacaaatataagtgtaaagaatgtgattataaaacagtgtggcaaaaaGATCTAAAGAAGCATATGAAATTTCacactggtgacaaatataagtgtatagaATGTGATTATCACACAGTTTGGAAACGTAGTCTAACtgaacatattaaaattcatataggcgacgaatataagtgtaaagaatgtgattataaaacagtgtggaaagatTCTCTGAAgtcacatatcaaaattcatacaagttgTTAA
Protein Sequence: MDVDAIEHCAIKPEIILTETFSFCGKYGDCSSEELKTEPVDYKESIKFKADVHAEHIETCEYKCEECDYKTLRKSNLKEHVKIHTGDEYKCKECDYKSVWKSNLKNHVRIHTGNKYKCTECDYKTLWKNNLKNHIKIHTGDEYKCEECDYKTVWKSHLMEHVKIHRGDEYKCEECEYKTLRKNILKEHVKIHTGDEYKCKECNYKTVWINNLKNHIKIHTGDKYKCKECDYKTVWQKDLKKHMKFHTGDKYKCIECDYHTVWKRSLTEHIKIHIGDEYKCKECDYKTVWKDSLKSHIKIHTSC

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -