Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010002186.1:194820-196356[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 13 0.032 0.45 11.2 0.2 1 19 68 86 68 87 0.96

2 13 3.1 44 4.9 5.1 1 23 86 108 86 108 0.95

3 13 0.043 0.6 10.8 0.8 1 23 140 162 140 162 0.98

4 13 0.0057 0.08 13.5 3.3 1 23 167 189 167 189 0.98

5 13 0.013 0.18 12.4 1.4 1 23 194 216 194 216 0.99

6 13 0.0013 0.019 15.5 1.6 1 23 221 243 221 243 0.98

7 13 0.017 0.24 12.1 3.4 1 23 248 270 248 270 0.99

8 13 0.0065 0.093 13.4 3.0 1 23 302 324 302 324 0.99

9 13 0.025 0.35 11.5 3.5 1 23 356 378 356 378 0.98

10 13 0.0063 0.09 13.4 2.2 1 23 383 405 383 405 0.99

11 13 2.7 39 5.1 4.3 1 23 410 432 410 432 0.94

12 13 0.00046 0.0065 17.0 2.4 1 23 437 459 437 459 0.98

13 13 0.011 0.16 12.6 3.5 1 23 464 486 464 486 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	13	0.032	0.45	11.2	0.2	1	19	68	86	68	87	0.96
2	13	3.1	44	4.9	5.1	1	23	86	108	86	108	0.95
3	13	0.043	0.6	10.8	0.8	1	23	140	162	140	162	0.98
4	13	0.0057	0.08	13.5	3.3	1	23	167	189	167	189	0.98
5	13	0.013	0.18	12.4	1.4	1	23	194	216	194	216	0.99
6	13	0.0013	0.019	15.5	1.6	1	23	221	243	221	243	0.98
7	13	0.017	0.24	12.1	3.4	1	23	248	270	248	270	0.99
8	13	0.0065	0.093	13.4	3.0	1	23	302	324	302	324	0.99
9	13	0.025	0.35	11.5	3.5	1	23	356	378	356	378	0.98
10	13	0.0063	0.09	13.4	2.2	1	23	383	405	383	405	0.99
11	13	2.7	39	5.1	4.3	1	23	410	432	410	432	0.94
12	13	0.00046	0.0065	17.0	2.4	1	23	437	459	437	459	0.98
13	13	0.011	0.16	12.6	3.5	1	23	464	486	464	486	0.98

Sequence Information

Coding Sequence: atggATATAGAATATAATGAAAGTTACCCGATAAAATCAGATATAACTGTACAGGAAACATTTTCATATTGCAGAAATTATGAAGATGATGGGAATGAAGAATTGAAACCAGACCTGATAAAGATAGAAAAATCATTGAAATGCGAAAAAGAGGGTCATCTGGGGGAGCTCACTGATGTATGTGCTGTACCCATACATCAATATagttgtaatgaatgtaattttgttacaaCGGAGAAAGATTCTTTAATACAAcacaagtgtaaagaatgtgattataaagcgCTACATAAACAGAGACTtaagcaacatttaaaaattcatactgatcaaaaatataagtgtaaccattgtgattatgaaacattgtggaaacaaagtctaatggtacatttaaaaattcatactggtgatgaatataagtgtcaagaatgtgtttataaaacaccatggaaaaatgatctaaagaaacatataaaaattcatactggcgaagattataagtgtaaggaatgtgattataaaacactaagtaaaaatcatctaaaggaacatatgttaattcatactggcgaagaatacaagtgtaaggaatgtgagtataaaacaccatggaaacagaatctaaagacacatttaaaaattcatactggtgaagaatataagtgtaaggaatgtgattataaaacactaagGAAAgattatctaaaggaacatatgttaattcatactggtaatgaatataagtgtaaggaatgtgattttaaaacaccgtggaaacataatctaaagacacatttaaaaattcatactggtgatgaacaTAATTGTAAccattgtgattataaaacattgtggaaaCCAAGTCTAAtggtacatttaaaaattcatacgggtgatgaatataagtgtaaggaatgtggttttaaaacaccatggaaacataatctaaaaacacatttaaaaattcatactggtaatgaacataagtgtaaccattgtgattataaaacattgtggaaacatacactaaaggaacatatgttaattcatactggcgaagaatttaagtgtaaggaatgtgattttaaaacaccatggaaacataatctaaagacacatttaaaaattcatacggataatgaatataagtgtaagaaatgtaattataaaacaccttggaaaaatgatctaaaaaaacatatcaaaattcatactggcgaaggatataagtgtaaggaatgtgattttaaaacactgtggaaaaCGAATCTaaagacacatttaaaaattcatactggtgatgaacataagtgtaagaaatgtgattataaaacaccaagGGAAgattatctaaaggaacatatgttaattcatactggtgatgaatataagtgtaagaaatgtgattttaaaacagtatggaaacataatttaaaaagacaCATTGAAATTCATATGCGTAATAACCTAATAAGCATCTAA
Protein Sequence: MDIEYNESYPIKSDITVQETFSYCRNYEDDGNEELKPDLIKIEKSLKCEKEGHLGELTDVCAVPIHQYSCNECNFVTTEKDSLIQHKCKECDYKALHKQRLKQHLKIHTDQKYKCNHCDYETLWKQSLMVHLKIHTGDEYKCQECVYKTPWKNDLKKHIKIHTGEDYKCKECDYKTLSKNHLKEHMLIHTGEEYKCKECEYKTPWKQNLKTHLKIHTGEEYKCKECDYKTLRKDYLKEHMLIHTGNEYKCKECDFKTPWKHNLKTHLKIHTGDEHNCNHCDYKTLWKPSLMVHLKIHTGDEYKCKECGFKTPWKHNLKTHLKIHTGNEHKCNHCDYKTLWKHTLKEHMLIHTGEEFKCKECDFKTPWKHNLKTHLKIHTDNEYKCKKCNYKTPWKNDLKKHIKIHTGEGYKCKECDFKTLWKTNLKTHLKIHTGDEHKCKKCDYKTPREDYLKEHMLIHTGDEYKCKKCDFKTVWKHNLKRHIEIHMRNNLISI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -