Lyun009449.1
Basic Information
- Insect
- Lamprigera yunnana
- Gene Symbol
- -
- Assembly
- GCA_013368075.1
- Location
- JABVZV010001756.1:9142-11298[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 13 5.1 71 4.3 1.6 1 23 87 109 87 109 0.94 2 13 0.0002 0.0028 18.1 2.1 1 23 114 136 114 136 0.99 3 13 0.035 0.49 11.1 1.7 1 23 141 163 141 163 0.98 4 13 1.2 16 6.3 2.4 1 23 168 190 168 190 0.97 5 13 0.06 0.85 10.3 3.0 1 23 195 217 195 217 0.98 6 13 1 14 6.5 6.2 1 23 222 244 222 244 0.98 7 13 0.0058 0.082 13.5 1.1 1 23 249 271 249 271 0.98 8 13 1.8 26 5.6 3.1 1 23 276 298 276 298 0.94 9 13 0.00017 0.0024 18.3 2.2 1 23 303 325 303 325 0.99 10 13 6.2 88 4.0 3.7 1 23 330 352 330 352 0.91 11 13 0.00018 0.0025 18.3 3.3 1 23 357 379 357 379 0.99 12 13 0.024 0.34 11.6 1.2 1 23 384 406 384 406 0.98 13 13 0.0003 0.0043 17.6 1.2 1 23 411 433 411 433 0.99
Sequence Information
- Coding Sequence
- ATGGATGTTAACTATAATAAAAGTTACCCAATAAAATCGGAAGTGGTTGTAAACGAAACATATTCATACTATGAgaaatatgaagattatggGAACAAAGAATTGAAAATGGAGCTCTTAAATTTCGAAGAAGATAATCTCGAGGGGCAAACCAATATACATGATAAGTATATAAATCAAGATATttataatgaaagtaattttattaaaacagagAAAGTTTCTCTAATAGAACATTTGCaaactaaaaatgttttatacttTTGTCAGGAATGCGTGTATAAAACACAGTGGAAAcggagtctaaaggaacacacgagaattcatactggtgatgaatataaatgtacggaatgtgactataaaacagtgcgcaaacagagtctaaaggaacatacaaaaattcatactggtgacaaatataaatgtaaggaatgtgattataaaacacggtGGAAAAGGAGTCTAAAAggacatgtaaaaattcacactggtgatgaacataaatgtaaggaatgtgattttaaaacaccttGGAAACAAAGTCTGAGTgaacatacaaaaattcatagtggtgatgaatataaatgtaaagaatgcaattataaaacacaatggactcagaatctaaagaaacatgcaAGAactcatactggtgatgaacataagtgtaaagaatgtgattataaaactcaGTGCAAAAgtagtttaaaggaacatgtaaaaattcacactggtgatgaatataagtgtaaagaatgtgattataaaacacggtGGAAAGGAAgcctaaaggaacatgtgaaaattcatagtggtgatgaatataaatgtaatgaatgtgattataaaacgctgtggaaacagaatctaaaggaacatacaaaaattcatgctggtgatgaatataagtgtaaggaatgtgattataaaacaccgcGAAAACAGAGattaaaggaacatatgaaaattcatagtgatgatgaatataagtgcaatgaatgtgattttaaaacgctgtggaaacagaatctaaaagaacatacaaaaattcatgacggtgatgaatataagtgtaaagaatgtgattataagacagtgcacaaacagagtctaaaggaacatataaaaattcacactggtgacgaatataaatgtaatgaatgtaattataaaacaccgtggaaacaaaatctaaaagaaCATAATAGAATACATACTGGTCATGAATATAAAtgcaaggaatgtgactataaaacagtatggaaaaataatttagaaagacatatgaaaatacattttatttatttagtgtaa
- Protein Sequence
- MDVNYNKSYPIKSEVVVNETYSYYEKYEDYGNKELKMELLNFEEDNLEGQTNIHDKYINQDIYNESNFIKTEKVSLIEHLQTKNVLYFCQECVYKTQWKRSLKEHTRIHTGDEYKCTECDYKTVRKQSLKEHTKIHTGDKYKCKECDYKTRWKRSLKGHVKIHTGDEHKCKECDFKTPWKQSLSEHTKIHSGDEYKCKECNYKTQWTQNLKKHARTHTGDEHKCKECDYKTQCKSSLKEHVKIHTGDEYKCKECDYKTRWKGSLKEHVKIHSGDEYKCNECDYKTLWKQNLKEHTKIHAGDEYKCKECDYKTPRKQRLKEHMKIHSDDEYKCNECDFKTLWKQNLKEHTKIHDGDEYKCKECDYKTVHKQSLKEHIKIHTGDEYKCNECNYKTPWKQNLKEHNRIHTGHEYKCKECDYKTVWKNNLERHMKIHFIYLV
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -