Lyun002135.1
Basic Information
- Insect
- Lamprigera yunnana
- Gene Symbol
- -
- Assembly
- GCA_013368075.1
- Location
- JABVZV010000335.1:8754-10998[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 14 0.00099 0.014 15.9 1.1 1 23 94 116 94 116 0.96 2 14 2.1e-05 0.00029 21.2 2.9 1 23 121 143 121 143 0.99 3 14 0.011 0.16 12.6 0.5 1 23 148 170 148 170 0.98 4 14 3.5 50 4.8 2.2 1 23 175 197 175 197 0.93 5 14 0.038 0.54 10.9 2.2 1 23 202 224 202 224 0.98 6 14 1.5 21 5.9 0.7 1 23 229 251 229 251 0.89 7 14 7.9e-05 0.0011 19.4 3.5 1 23 256 278 256 278 0.99 8 14 0.0044 0.062 13.9 1.0 1 23 283 305 283 305 0.98 9 14 0.32 4.6 8.0 2.2 1 23 310 332 310 332 0.98 10 14 2.9 42 5.0 4.9 1 21 337 357 337 359 0.95 11 14 0.15 2.1 9.1 1.7 1 23 364 386 364 386 0.98 12 14 2.5e-05 0.00035 21.0 2.3 1 23 391 413 391 413 0.99 13 14 0.0036 0.051 14.2 0.9 1 23 418 440 418 440 0.98 14 14 0.045 0.64 10.7 2.5 1 23 445 467 445 467 0.98
Sequence Information
- Coding Sequence
- ATGGATATTAAGATGAacgatttaaatgaaagttgtcgGATAAAAACGGAAGTGATTGTAAATGAAACGTTTTCGTATCACGAAGatTGTGGGAGTCATGAATTCAAATCGGAGCCGGTGGATTTTGAAGCACCGTTTAAATATAAGACTGAAGAAGATATTATAGAGCACATAAATATACCTGCTGTTCCCGTACAATacttttgtaatgaatgtacgTTTAAAACGCAATGCAAATATTATTTACAGAAGCATGAGAAGATTCATTCAGGTATTGAATATAtctgtaaggaatgtgattataagtcGTTGAGGAAATctaatttaacagtacatacgaggattCATACAGATGGTAAATATCAGTGTAaggattgtgattataaatcgCGATCGAAAtattatctaaaggaacatatgaaaattcatgtaggtgatgaatataagtgtgcagtttgtgattataaaacatggAGAAAAGATAGTTTAAAAGAAcacgtgaaaattcatactggtgatgaatataagtgtcagGAATGTAATTATAGAACACCATGGAAACAATGCATAAAAGAGCACGTGAGAAtccacacaggtgatgaatataagtgtgatgAATGCAACTATAAAACACCTTGGAAGAACCAGTTCAAAACACATATGAAACTTCATATCCGTATAGAATTCAAGTGTGATGAATGCgactataaaacaccatgggACAACCAGTTCAAAACACATGCGAAAATTCACACTAATGATAAATACAAGTGTAaggattgtgattataaatctCGATCGAAATTttatctaaaggaacacatgaaaattcatgtcggtgatgaatataagtgtacggtttgtgattataaaacatggAGAAAAGATAGTTTAaaagaacatgtgaaaattcatactggtgatgaatataagtgtcaggaatgtgattataggACGCCATGGAAACAATGTATAAAAGAACACATGAGGATTCAcacgggtgatgaatataagtgtgacgAATGCAACTATAAAACACCTTGGAAAAATCAGTTCAAAACACATATGAAATGTCACACGGgtattgaatataagtgtgatgaatgcgattataaaacaccttGGAACAACCAGttcaaaacacataagaaaattcACACAGATGATAAATATGAGTGTAaggattgtgattataaatctCGATCGAAATATTATCTAAAAgaacacatgaaaattcatgtgggtgatgaatacaagtgtacaggttgtgattataaaacatggAGAAAAGATAGTTTAaaagaacatgtgaaaattcatacaggtgatgaatataagtgtagcgAATGTAATTATAAGACGCCTTGGAAAAATCAGttcaaaaaacatattaaacTTCACACGGGTATTGAATACAAGTGTGATGAacgtgattataaaacaccgtaG
- Protein Sequence
- MDIKMNDLNESCRIKTEVIVNETFSYHEDCGSHEFKSEPVDFEAPFKYKTEEDIIEHINIPAVPVQYFCNECTFKTQCKYYLQKHEKIHSGIEYICKECDYKSLRKSNLTVHTRIHTDGKYQCKDCDYKSRSKYYLKEHMKIHVGDEYKCAVCDYKTWRKDSLKEHVKIHTGDEYKCQECNYRTPWKQCIKEHVRIHTGDEYKCDECNYKTPWKNQFKTHMKLHIRIEFKCDECDYKTPWDNQFKTHAKIHTNDKYKCKDCDYKSRSKFYLKEHMKIHVGDEYKCTVCDYKTWRKDSLKEHVKIHTGDEYKCQECDYRTPWKQCIKEHMRIHTGDEYKCDECNYKTPWKNQFKTHMKCHTGIEYKCDECDYKTPWNNQFKTHKKIHTDDKYECKDCDYKSRSKYYLKEHMKIHVGDEYKCTGCDYKTWRKDSLKEHVKIHTGDEYKCSECNYKTPWKNQFKKHIKLHTGIEYKCDERDYKTP
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -