Lyun004860.1
Basic Information
- Insect
- Lamprigera yunnana
- Gene Symbol
- -
- Assembly
- GCA_013368075.1
- Location
- JABVZV010000835.1:769873-771159[+]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 14 0.0018 0.025 15.1 1.2 1 23 9 31 9 31 0.98 2 14 9.2e-06 0.00013 22.3 2.8 1 23 36 58 36 58 0.99 3 14 0.00094 0.013 16.0 1.7 1 23 63 85 63 85 0.99 4 14 4e-05 0.00057 20.3 2.6 1 23 90 112 90 112 0.99 5 14 5.3 75 4.2 3.1 1 23 117 139 117 139 0.86 6 14 0.082 1.2 9.9 0.7 1 23 144 166 144 166 0.98 7 14 3.9e-05 0.00055 20.4 2.9 1 23 171 193 171 193 0.99 8 14 0.19 2.7 8.8 0.7 1 23 198 220 198 220 0.96 9 14 1.7e-05 0.00025 21.5 2.9 1 23 225 247 225 247 0.99 10 14 7.1 1e+02 3.8 1.8 1 18 279 296 279 298 0.79 11 14 0.082 1.2 9.9 0.7 1 23 315 337 315 337 0.98 12 14 3.9e-05 0.00055 20.4 2.9 1 23 342 364 342 364 0.99 13 14 0.044 0.62 10.8 0.5 1 23 369 391 369 391 0.98 14 14 7 99 3.8 1.1 1 9 396 404 396 406 0.87
Sequence Information
- Coding Sequence
- ATGAAACTTCATaatggtgataaatataagtgtaaggaatgtgattataaatcagtTAGGAAACGGAGACTAattgaacatgtaaaaattcatactggtgatgaatataagtgcaaagaatgtaactataaaacagtgagaagagataatctaaagaaacatctgaaaattcatactggtgttgaatataagtgcaaggaatgtgattatacaaCACATGGGAAACCGAGTCTAatggaacatatgaaaattcatattggtgatgaatataggtgtaaagaatgtaactataGAACAATGAGAAAAgttaatctaaagaaacatataaaaattcatactggtgatgaatataagtgtaaggaatgtgattataaaacactgtggaaacagaatctaaagggacatgtaaaaattcatagtggtgatgaatataagtgtacggaatgtgattataaaacagtttggaaacaGAAATTAatggaacatgtaaaaattcataatggtgatgaatataagtgtaaagaatgtaccTATAGAACAGTGAGGAAAGATAGTCTAaagaaacatttgaaaattcatactggtgatgaatataaatgtaaggaatgtgattataaaacagtttggaaacgGAGACTAattgaacatgtaaaaattcataatggtgatgaatataagtgtaaagaatgtaactataaaacagtgagaaaagatagtctaaagaaacatttgaaaattcatactggtgatgaatataagtgcaaggaatgtgattataaaacactgtggaaacaGAGTGTAAtggaacatttgaaaattcatactggtgatgaacataagtgtaaagaatgtaactataGAACAATGAGAAAgaatgtgattataaaacactgtggaaaacagaatctaaagggacatgtaaaaattcatagtggtgatgaatataagtgtacggaatgtgattataaaacagtttggaaacaGAAATTAatggaacatgtaaaaattcataatggtgatgaatataagtgtaaagaatgtaccTATAGAACAGTGAGGAAAGATAGTCTAaagaaacatttgaaaattcatactggtgatgaatataaatgtaaggaatgtgattataaaacagtttggaaacaGACTTTAAtcgaacatgtaaaaattcatactggtgatgaatataagtgtaatgaatgtgattataaaacagtttggaacAGACTTTAA
- Protein Sequence
- MKLHNGDKYKCKECDYKSVRKRRLIEHVKIHTGDEYKCKECNYKTVRRDNLKKHLKIHTGVEYKCKECDYTTHGKPSLMEHMKIHIGDEYRCKECNYRTMRKVNLKKHIKIHTGDEYKCKECDYKTLWKQNLKGHVKIHSGDEYKCTECDYKTVWKQKLMEHVKIHNGDEYKCKECTYRTVRKDSLKKHLKIHTGDEYKCKECDYKTVWKRRLIEHVKIHNGDEYKCKECNYKTVRKDSLKKHLKIHTGDEYKCKECDYKTLWKQSVMEHLKIHTGDEHKCKECNYRTMRKNVIIKHCGKQNLKGHVKIHSGDEYKCTECDYKTVWKQKLMEHVKIHNGDEYKCKECTYRTVRKDSLKKHLKIHTGDEYKCKECDYKTVWKQTLIEHVKIHTGDEYKCNECDYKTVWNRL
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -