Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010000835.1:859191-861300[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 17 0.03 0.42 11.3 0.1 1 21 73 93 73 94 0.95

2 17 8.1 1.1e+02 3.6 5.2 1 23 100 122 100 122 0.97

3 17 2.5e-05 0.00036 20.9 2.7 1 23 168 190 168 190 0.99

4 17 0.48 6.9 7.5 3.7 1 23 195 217 195 217 0.97

5 17 0.62 8.8 7.1 0.3 1 23 222 244 222 244 0.95

6 17 0.00095 0.013 16.0 5.0 1 23 249 271 249 271 0.99

7 17 0.25 3.6 8.4 2.9 1 23 303 325 303 325 0.97

8 17 0.00011 0.0016 18.9 2.0 1 23 330 352 330 352 0.98

9 17 6.3e-05 0.0009 19.7 2.4 1 23 357 379 357 379 0.99

10 17 2.6e-05 0.00037 20.9 2.1 1 23 384 406 384 406 0.99

11 17 1.4 19 6.1 2.6 1 23 411 433 411 433 0.95

12 17 0.0021 0.03 14.9 1.1 1 23 438 460 438 460 0.98

13 17 0.66 9.3 7.1 3.8 1 23 492 514 492 514 0.97

14 17 2.6e-05 0.00037 20.9 2.1 1 23 539 561 539 561 0.99

15 17 1.4 19 6.1 2.6 1 23 566 588 566 588 0.95

16 17 0.0021 0.03 14.9 1.1 1 23 593 615 593 615 0.98

17 17 2.4 34 5.3 0.8 2 23 621 642 620 642 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	17	0.03	0.42	11.3	0.1	1	21	73	93	73	94	0.95
2	17	8.1	1.1e+02	3.6	5.2	1	23	100	122	100	122	0.97
3	17	2.5e-05	0.00036	20.9	2.7	1	23	168	190	168	190	0.99
4	17	0.48	6.9	7.5	3.7	1	23	195	217	195	217	0.97
5	17	0.62	8.8	7.1	0.3	1	23	222	244	222	244	0.95
6	17	0.00095	0.013	16.0	5.0	1	23	249	271	249	271	0.99
7	17	0.25	3.6	8.4	2.9	1	23	303	325	303	325	0.97
8	17	0.00011	0.0016	18.9	2.0	1	23	330	352	330	352	0.98
9	17	6.3e-05	0.0009	19.7	2.4	1	23	357	379	357	379	0.99
10	17	2.6e-05	0.00037	20.9	2.1	1	23	384	406	384	406	0.99
11	17	1.4	19	6.1	2.6	1	23	411	433	411	433	0.95
12	17	0.0021	0.03	14.9	1.1	1	23	438	460	438	460	0.98
13	17	0.66	9.3	7.1	3.8	1	23	492	514	492	514	0.97
14	17	2.6e-05	0.00037	20.9	2.1	1	23	539	561	539	561	0.99
15	17	1.4	19	6.1	2.6	1	23	566	588	566	588	0.95
16	17	0.0021	0.03	14.9	1.1	1	23	593	615	593	615	0.98
17	17	2.4	34	5.3	0.8	2	23	621	642	620	642	0.95

Sequence Information

Coding Sequence: ATGGATGTCgattataatgaaagttatcaaATAAAAACGGAAGTGGGTAACGCGGAAGTGATTGTAAAGgaaactttttcattttatgGAAAATACGAAGATTATGCGAGTGGAGATTTTAAAACGGAGGTGGTAGATTTTGAAGAATCTATTAAATGCGAAGAAGAATATAATCTTGGGCAGCACATCAATATACCTGACTTACCCGTACCTCGATAttattgtaatgaatgtaattttattacaacggaGAAAGACTCTCTAATAgagcatttgaaaattactagaagtatgcaatatttttgtaacgaatGTAATTTTAACACCAGTTTTTCATGTTCGATAAAAGAACATTTCAGGATGCATAACAGCGTTGGTTGTAgacatattactaaaaaatgtatctttaaGACACCACAAATTATCTCCTCGACACCACAGTTCAAAACACCTTGGAGATTGAGGGTAGATGAACATGTGGACATTTatagtggtgatgaatataagtgtaaggaatgtaactataaaacagcgagaaaagatagtctaaagaaacatctaaaaattcatactggtgttgaatataagtgtaaggaatgtgattataaaacactgtggaaacggaatctaaaggaacatatgaaaattcatactggtgatgaatataagtgtgagggatgtgattataaaacagtttggaaacaGAGACTAAtcgaacatgtaaaaattcatactggtgatgaatataaatgtaaagaatgtaactataaaacagtgagaaaagaTTGTCTAAAGACACATCTGAAAATTCATTCtggtgttgaatataagtgtaaggaatgtgattataaaacactgtggaaacagtgtctaaaggaacatacgAAAATTCATTCTGAtggtgaatataagtgtaacgaatgtgattataaaacattgtggaaaCAAAACCTAAGGCGACATATAAACATTCATACTAGTGATGAATAtatgtgtaaggaatgtaactataaaacagtaaggaAAGCCAAGCTtaagaaacatataaaaattcatactgatgataaatataagtgtaaggaatgtaactataaaacagtgagaaaatataatttaaaggaacatgtgaaaattcatactggtgatgaatataagtgtaaggaatgtaattataaaaccgTCAGAAAAGATAGTCTAAggcaacatataaaaattcatacaggtgacaaatacgagtgtaaagaatgtgattataaaacgctgTGGAAACGGAGCTTgaaggaacatatgaaaattcatactggtgaagaatataagtgtaaggaatgtaactataaaacagtgaggaaagcGAGGCTTatggaacatgtgaaaattcatactgatgataaatataagtgtaaggaatgtgattataaaacactgtggaaacagtgtctaaaggaacatatgaaaattcatactgatgataaatataagtgtaaggaatgtaactataaaacattgtggaaaCAAAACCTAAGGCGACATATAAACATTCATActagtgatgaatataagtgtaaggaatgtaactataaaacagaacatgtgaaaattcatactggtgatgaatataagtgtaaggaatgtaattataaaaccgTCAGAAAAGATAGTCTAAggcaacatataaaaattcatacaggtgacaaatacgagtgtaaagaatgtgattataaaacgctgTGGAAACGGAGCTTgaaggaacatatgaaaattcatactggtgaagaatataagtgtaaggaatgtaactataaaacagtgaggaaagcGAGGCTTatggaacatgtgaaaattcatactgatgatgaatctaagtgtaaggaatgtgattataaaacaatttggaaACAGAGATTAacggaacatgtcaaaattcatacccaTGATGAATATAAACGTGTAAGGAATTAA
Protein Sequence: MDVDYNESYQIKTEVGNAEVIVKETFSFYGKYEDYASGDFKTEVVDFEESIKCEEEYNLGQHINIPDLPVPRYYCNECNFITTEKDSLIEHLKITRSMQYFCNECNFNTSFSCSIKEHFRMHNSVGCRHITKKCIFKTPQIISSTPQFKTPWRLRVDEHVDIYSGDEYKCKECNYKTARKDSLKKHLKIHTGVEYKCKECDYKTLWKRNLKEHMKIHTGDEYKCEGCDYKTVWKQRLIEHVKIHTGDEYKCKECNYKTVRKDCLKTHLKIHSGVEYKCKECDYKTLWKQCLKEHTKIHSDGEYKCNECDYKTLWKQNLRRHINIHTSDEYMCKECNYKTVRKAKLKKHIKIHTDDKYKCKECNYKTVRKYNLKEHVKIHTGDEYKCKECNYKTVRKDSLRQHIKIHTGDKYECKECDYKTLWKRSLKEHMKIHTGEEYKCKECNYKTVRKARLMEHVKIHTDDKYKCKECDYKTLWKQCLKEHMKIHTDDKYKCKECNYKTLWKQNLRRHINIHTSDEYKCKECNYKTEHVKIHTGDEYKCKECNYKTVRKDSLRQHIKIHTGDKYECKECDYKTLWKRSLKEHMKIHTGEEYKCKECNYKTVRKARLMEHVKIHTDDESKCKECDYKTIWKQRLTEHVKIHTHDEYKRVRN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -