Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010000480.1:69178-70868[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 14 0.027 0.38 11.4 1.1 1 23 135 157 135 157 0.97

2 14 0.028 0.4 11.4 3.7 1 23 162 184 162 184 0.98

3 14 0.0026 0.037 14.6 1.1 1 23 189 211 189 211 0.98

4 14 0.00045 0.0064 17.0 0.5 1 23 216 238 216 238 0.99

5 14 0.03 0.43 11.3 0.6 1 23 243 265 243 265 0.98

6 14 7.1 1e+02 3.8 0.1 1 9 270 278 270 292 0.84

7 14 8.9e-05 0.0013 19.2 0.8 1 23 297 319 297 319 0.98

8 14 5.1e-05 0.00073 20.0 2.8 1 23 324 346 324 346 0.99

9 14 0.017 0.24 12.0 1.0 1 23 351 373 351 373 0.98

10 14 0.021 0.3 11.7 3.9 1 23 380 402 380 402 0.98

11 14 0.032 0.45 11.2 0.5 1 23 407 429 407 429 0.98

12 14 0.0006 0.0085 16.6 1.0 1 23 434 456 434 456 0.98

13 14 0.018 0.25 12.0 1.4 1 23 461 483 461 483 0.98

14 14 0.021 0.3 11.8 3.4 1 23 488 510 488 510 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	14	0.027	0.38	11.4	1.1	1	23	135	157	135	157	0.97
2	14	0.028	0.4	11.4	3.7	1	23	162	184	162	184	0.98
3	14	0.0026	0.037	14.6	1.1	1	23	189	211	189	211	0.98
4	14	0.00045	0.0064	17.0	0.5	1	23	216	238	216	238	0.99
5	14	0.03	0.43	11.3	0.6	1	23	243	265	243	265	0.98
6	14	7.1	1e+02	3.8	0.1	1	9	270	278	270	292	0.84
7	14	8.9e-05	0.0013	19.2	0.8	1	23	297	319	297	319	0.98
8	14	5.1e-05	0.00073	20.0	2.8	1	23	324	346	324	346	0.99
9	14	0.017	0.24	12.0	1.0	1	23	351	373	351	373	0.98
10	14	0.021	0.3	11.7	3.9	1	23	380	402	380	402	0.98
11	14	0.032	0.45	11.2	0.5	1	23	407	429	407	429	0.98
12	14	0.0006	0.0085	16.6	1.0	1	23	434	456	434	456	0.98
13	14	0.018	0.25	12.0	1.4	1	23	461	483	461	483	0.98
14	14	0.021	0.3	11.8	3.4	1	23	488	510	488	510	0.99

Sequence Information

Coding Sequence: ATGGATATTAATTCTACTGAAAGTTGTACAATAAAATCggaaattattttaacagaaacattttgtgGAAACTATGAAAATTGTGGTAATGAAAAACTGAAAACGGAGCCAGTAGATTACAAAGAATTGATTAAGGGTAAGGAAGAAGATGATCCTGCAGAGCATATGGATACATCTGTTGCCCCAGTACAACAATGTTCTGGTAGACATTTAAAAACTATCAAAAATGTTGAATATGTTTGTAAGCAATGTAACTTTAGAACTCATTTGGAATGTTTCATGAAAAAGCATTTGAAAGTTCACAAGGGTGAAGATGAAGCTTATATTACtaaggaatgtaattttaagatgcCACAGAGTTTCTCTTTAGCACCACACGTAAAAACGTCAACAACTGAtgaatacatttgtaataaatgtaattttatcacGTTAAACAAGAATTCTCTAAGGAAACATATGATAATCCATAaaggtgatgaatacaagtgtaaagaatgtgattataaaacaaagtggaaacatagtctaaaggaacatgtcaaaattcatacaggtggggaatataagtgtaaagaatgtgattataaaacagtgtggaaatataatctaaaggtacatgtcaaaattcatacaaatgatgaatataagtgtaaagaatgtgattataaaacagtgcggataccaagtctaaaggaacatatcaaaattcatacaaatgatgaatataagtgtaatgaatgtgattataaaacaccgtggaaaagacttctaaaggaacatgtcaaaattcataaagcTGACAAATATAcatgtaacgaatgtgattataaaacatggtGGGAACGTAGTCTAAGGGAACATGTGGTaatccatacaggtgatgaatatatgtgcaaagagtgtgattacaaaacaatacGGAAACGTAATCTAATggcacatgtcaaaattcatacaggtgagaaatataagtgtaacgattgtggttataaaacagtgcggaaacatagtctaaaggaacatgtcaaaattcatacaggtgaggaatataagtgtaaagattgtgattataaaacagtatggaaacaaagtctaaaggaacatgtcaaaattcatacaggtgaatttgaagaatataagtgtaaagaatgtgattataaaacattgcggaaacatagtctaaaggaacatgtcaaaattcatacaaatgatgaatataagtgtaacgaatgtgattataaaacaccatggaaaaaaggtctaaaggaacatgtcaaaattcataaagaTGACAAATATacgtgtaacgaatgtgattataaaacatcagcgaaatatagtctaaaggaacatgttaaaattcataccggtgaggaatataagtgtaaagagtgtgattataaaacagtgtggaaacaaagtctaaagcaacatgtcaaaattcatacaggtgatgaatataaatgtaaagaatgtaattataaaacagtgtggaaaaaacaactaaaatcaCATTTGAAAAGACATACAGATGATTTACATATCTGA
Protein Sequence: MDINSTESCTIKSEIILTETFCGNYENCGNEKLKTEPVDYKELIKGKEEDDPAEHMDTSVAPVQQCSGRHLKTIKNVEYVCKQCNFRTHLECFMKKHLKVHKGEDEAYITKECNFKMPQSFSLAPHVKTSTTDEYICNKCNFITLNKNSLRKHMIIHKGDEYKCKECDYKTKWKHSLKEHVKIHTGGEYKCKECDYKTVWKYNLKVHVKIHTNDEYKCKECDYKTVRIPSLKEHIKIHTNDEYKCNECDYKTPWKRLLKEHVKIHKADKYTCNECDYKTWWERSLREHVVIHTGDEYMCKECDYKTIRKRNLMAHVKIHTGEKYKCNDCGYKTVRKHSLKEHVKIHTGEEYKCKDCDYKTVWKQSLKEHVKIHTGEFEEYKCKECDYKTLRKHSLKEHVKIHTNDEYKCNECDYKTPWKKGLKEHVKIHKDDKYTCNECDYKTSAKYSLKEHVKIHTGEEYKCKECDYKTVWKQSLKQHVKIHTGDEYKCKECNYKTVWKKQLKSHLKRHTDDLHI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -