Basic Information

Gene Symbol
-
Assembly
GCA_013368075.1
Location
JABVZV010001135.1:44268-46003[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 12 1.4 20 6.0 2.1 1 17 68 84 68 85 0.90
2 12 0.036 0.51 11.0 0.3 5 23 90 108 88 108 0.96
3 12 0.016 0.23 12.1 0.6 2 23 114 135 113 135 0.97
4 12 0.0073 0.1 13.2 1.0 2 23 141 162 140 162 0.97
5 12 0.0018 0.026 15.1 2.0 2 23 168 189 167 189 0.96
6 12 0.0023 0.033 14.8 0.8 2 23 195 216 194 216 0.96
7 12 0.00084 0.012 16.2 2.7 2 23 222 243 221 243 0.97
8 12 5.9e-06 8.4e-05 22.9 1.4 2 23 249 270 248 270 0.97
9 12 0.13 1.9 9.2 1.0 2 23 276 297 275 297 0.97
10 12 0.00066 0.0094 16.5 0.6 2 23 303 324 302 324 0.94
11 12 0.00014 0.002 18.6 1.3 2 23 330 351 329 351 0.97
12 12 4e-05 0.00056 20.3 0.6 2 23 357 378 356 378 0.96

Sequence Information

Coding Sequence
ATGGATGTTGATTGCAACGAAAGTTGTTCAATAAAATCTGAGGTGACtctaacagaaacattttctttttgtggagaaTACAGAGAGTATGtgaataaagaatttaaatctgAGCCAGTAGATGTTGAAGAGTCTTTTAAATGCAAGGAAGAAGATAACTCTGCAAAGCATATCGATATATCTGCCGATCCTGTACAGCAATATACttgtaatgattgtaatttTACAACAACGGAAAAGGATTGTCTAATAAAACAACTGACCAgggaatgtgactacaaaacttcTTTGAAATGGTCATTAAAAGagcatatgagaattcatacaggtgatgaattaaAATGCAAAGAATGTAACTACAAAACTCCATGGACAGCGTCATTAAAAAaccatatgagaattcatacaggtgataaattgaaatgtaaagaatgtgactacaaaactccttggaaatatttattaaaagaccATATGAGAaatcatacaggtgataaattaaaatgtaaagaatgtgactacaaaactcttACGAAATATGATCTTAACACACATATGAGAAATCATACTGCTGATGAATtgaaatgtaaggaatgtgactataaaactgtgTTGAAACAAGATCTTAAAAAACATCTGGAAATTCACATAGGTAATGAATggaagtgtaaggaatgtgactacaaaactcctttcaaacatttattaaaaaaccatctgagaattcatacaagtgatggattgaaatgtaaggaatgtgactacaaaactcctaGGAAATCACTATTAAAGcaacatatgagaattcatacaggtcatgaattgaaatgtaaagaatgtgacttcAAAACTCCTTGGACAGAGTCATTCAAAAgtcatatgagaattcatacaggtctTGAATTGAAATGTatagaatgtgactacaaaactcctaGGAAATATGATCTTAACAcgcatatgagaattcatacaggtgatgaattgaaatgtaaagaatgtgactacaaaactcctaGGAAATATCTATTAAAAGAACATACGAGagttcatacaggtgataaattgaattgcaaagaatgtgactacGAAACTCCTAGGAAATATCTATTAAAAcaacatatgagaattcatacagatgatgaaCTGAAGTGA
Protein Sequence
MDVDCNESCSIKSEVTLTETFSFCGEYREYVNKEFKSEPVDVEESFKCKEEDNSAKHIDISADPVQQYTCNDCNFTTTEKDCLIKQLTRECDYKTSLKWSLKEHMRIHTGDELKCKECNYKTPWTASLKNHMRIHTGDKLKCKECDYKTPWKYLLKDHMRNHTGDKLKCKECDYKTLTKYDLNTHMRNHTADELKCKECDYKTVLKQDLKKHLEIHIGNEWKCKECDYKTPFKHLLKNHLRIHTSDGLKCKECDYKTPRKSLLKQHMRIHTGHELKCKECDFKTPWTESFKSHMRIHTGLELKCIECDYKTPRKYDLNTHMRIHTGDELKCKECDYKTPRKYLLKEHTRVHTGDKLNCKECDYETPRKYLLKQHMRIHTDDELK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-