Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010002186.1:120224-122174[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 18 0.08 1.1 9.9 0.1 1 21 68 88 68 89 0.95

2 18 0.0055 0.078 13.6 1.0 1 23 157 179 157 179 0.98

3 18 0.12 1.7 9.4 1.3 1 23 184 206 184 206 0.98

4 18 0.001 0.014 15.9 3.2 1 23 211 233 211 233 0.98

5 18 0.045 0.64 10.7 1.7 1 23 238 260 238 260 0.98

6 18 0.013 0.19 12.4 1.7 1 23 265 287 265 287 0.98

7 18 0.22 3.1 8.6 3.9 1 23 292 314 292 314 0.98

8 18 0.27 3.8 8.3 4.2 1 23 319 341 319 341 0.98

9 18 1.5 21 6.0 2.1 1 23 346 368 346 368 0.95

10 18 0.00011 0.0015 19.0 1.7 1 23 373 395 373 395 0.98

11 18 0.0018 0.025 15.1 0.9 1 23 400 422 400 422 0.99

12 18 0.078 1.1 10.0 3.3 1 23 427 449 427 449 0.97

13 18 0.0021 0.03 14.9 0.8 1 23 454 476 454 476 0.99

14 18 0.00027 0.0038 17.7 3.7 1 23 481 503 481 503 0.98

15 18 0.075 1.1 10.0 1.8 1 23 508 530 508 530 0.98

16 18 0.05 0.7 10.6 1.1 1 23 535 557 535 557 0.98

17 18 0.001 0.015 15.9 1.6 1 23 562 584 562 584 0.98

18 18 0.016 0.22 12.2 1.0 1 23 589 611 589 611 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	18	0.08	1.1	9.9	0.1	1	21	68	88	68	89	0.95
2	18	0.0055	0.078	13.6	1.0	1	23	157	179	157	179	0.98
3	18	0.12	1.7	9.4	1.3	1	23	184	206	184	206	0.98
4	18	0.001	0.014	15.9	3.2	1	23	211	233	211	233	0.98
5	18	0.045	0.64	10.7	1.7	1	23	238	260	238	260	0.98
6	18	0.013	0.19	12.4	1.7	1	23	265	287	265	287	0.98
7	18	0.22	3.1	8.6	3.9	1	23	292	314	292	314	0.98
8	18	0.27	3.8	8.3	4.2	1	23	319	341	319	341	0.98
9	18	1.5	21	6.0	2.1	1	23	346	368	346	368	0.95
10	18	0.00011	0.0015	19.0	1.7	1	23	373	395	373	395	0.98
11	18	0.0018	0.025	15.1	0.9	1	23	400	422	400	422	0.99
12	18	0.078	1.1	10.0	3.3	1	23	427	449	427	449	0.97
13	18	0.0021	0.03	14.9	0.8	1	23	454	476	454	476	0.99
14	18	0.00027	0.0038	17.7	3.7	1	23	481	503	481	503	0.98
15	18	0.075	1.1	10.0	1.8	1	23	508	530	508	530	0.98
16	18	0.05	0.7	10.6	1.1	1	23	535	557	535	557	0.98
17	18	0.001	0.015	15.9	1.6	1	23	562	584	562	584	0.98
18	18	0.016	0.22	12.2	1.0	1	23	589	611	589	611	0.98

Sequence Information

Coding Sequence: ATGGATGTTGATTATAATGAAACTTATCCAATAAAATCGGAAATAATTGTAAACCAAACATTTTCACATTGTGGAAATTATGAAGATCTTGggaataaagaattgaaaatggACACTGAACATATAGAAGAATCTTTTATATGCAAAGAAGAGGATAACCTTGTCGGGCTCAGTGATGTACGTGGTGTACCTGTAAAtcattatatttgtaatgaatgtagtTTTATTACAACGGAGAAAGATTCTTTAATACAACACttgaacattattaaaaatgtttgctatttttgcaaagaatgtaattttgaaaCCCTGTTTGGATGTTCGATAAAAGAGCATTTCAGGATTCATAACAGGGTCGTTTGTCGACatactaaaaattgtaatttgaagatGTCGCGAATTTTCTCTTTAGCACCGCAAATACAGAATGTAAGgcgatattttaaaattcacagtgatcatgaatataactgtaacgattgtgattataaaacagtgttgAGAGACAGTTTAAAAGAACATAAGAAAATTCATATTGGTGACGGatataagtgcaaggaatgtaattttaaaacaatatggaaacagagtttaaacgaacatttaaaaatccatactggtgataaatataactgtaatgattgtgattataaaacagtgcagaaaCACAGGCTAaaagaacatatgaaaattcatactggtgacagaTTTAAGTGTaaggagtgtgattataaaacaccatggaaacgaAGTCTAAATACACATTTAAAactccatactggtgatgaatataagtgtagtgtttgtgattataaaacactgtatAAATacagtctaaaggaacatatcaaaattcatactggtgacggatataagtgtaaggaatgtcattataaaacaccatggaaacgaAGTCTAAATACACATTTAAAactccatactggtgatgaatacaagtgtagcgattgtgattacaaaacattgTACAAACGCTGTTTAAgcgaacatatgaaaattcataccggtgatggATATgagtgcaaggaatgtgattataaaacattatggaaacagaatctaaatgtacatttaaaaatccatactggtgataaatataactgtaatgattgtgattataaaacagtccAGAAACACGCTCTTAatgaacatatgaaaattcatactggtgacagaTATAAGtgcaatgaatgtgattataaaacaatatggaaaaagaGTCTAAAtgaacatatgagaattcatactggGGACGGacataagtgtaaggaatgtgattacaaaacaccatggaaacagaatctaaaaacacatttaaaactccatactggtgatgaatataagtgtagtgATTGCgattacaaaacaatatggaaacagaatctaaatgaacatatgaaaattcatactggtgacgaatataagtgtaaggaatgtgattacaaaacacgaAGGAAACAAACTCTACAAACACATTTAAAactccatactggtgatgaatatcaGTGTAGCAATtgtgattacaaaatattgtacaaaCGCAGTCTTAACGAACATATGAAAAGTCATACTGGTGACGGATATacttgtacagaatgtgattacaaaacaccatggaaacgaAGTCTAAATACTCATTTAAAACTCCAcactggtgatgagtataagtgtaacgattgtgattacaaaacattgTACAAAAGCAGTCTAAacgaacatatgaaaattcattcTGATGATAGATATgagtgcaaggaatgtgattacaaaacaatatggaaacggAGTCTAAAGgtacatttaaaaatgcatactggtgataaatataactGTAATGAtcgtgattataaaacagtgcagaaaCATAAGTAA
Protein Sequence: MDVDYNETYPIKSEIIVNQTFSHCGNYEDLGNKELKMDTEHIEESFICKEEDNLVGLSDVRGVPVNHYICNECSFITTEKDSLIQHLNIIKNVCYFCKECNFETLFGCSIKEHFRIHNRVVCRHTKNCNLKMSRIFSLAPQIQNVRRYFKIHSDHEYNCNDCDYKTVLRDSLKEHKKIHIGDGYKCKECNFKTIWKQSLNEHLKIHTGDKYNCNDCDYKTVQKHRLKEHMKIHTGDRFKCKECDYKTPWKRSLNTHLKLHTGDEYKCSVCDYKTLYKYSLKEHIKIHTGDGYKCKECHYKTPWKRSLNTHLKLHTGDEYKCSDCDYKTLYKRCLSEHMKIHTGDGYECKECDYKTLWKQNLNVHLKIHTGDKYNCNDCDYKTVQKHALNEHMKIHTGDRYKCNECDYKTIWKKSLNEHMRIHTGDGHKCKECDYKTPWKQNLKTHLKLHTGDEYKCSDCDYKTIWKQNLNEHMKIHTGDEYKCKECDYKTRRKQTLQTHLKLHTGDEYQCSNCDYKILYKRSLNEHMKSHTGDGYTCTECDYKTPWKRSLNTHLKLHTGDEYKCNDCDYKTLYKSSLNEHMKIHSDDRYECKECDYKTIWKRSLKVHLKMHTGDKYNCNDRDYKTVQKHK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -