Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010001223.1:8826804-8828360[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 15 0.13 1.9 9.2 0.1 2 21 60 79 59 80 0.93

2 15 5.7 81 4.1 5.5 1 23 86 108 86 108 0.96

3 15 0.1 1.4 9.6 0.8 1 23 143 165 143 165 0.97

4 15 7.8e-05 0.0011 19.4 3.6 1 23 170 192 170 192 0.99

5 15 0.0031 0.043 14.4 1.2 1 23 197 219 197 219 0.99

6 15 0.00076 0.011 16.3 1.5 1 23 234 256 234 256 0.98

7 15 0.0017 0.024 15.2 0.2 1 23 261 283 261 283 0.98

8 15 0.0081 0.12 13.1 0.6 1 23 288 310 288 310 0.98

9 15 0.0069 0.098 13.3 0.6 1 23 315 337 315 337 0.98

10 15 0.013 0.19 12.4 3.6 1 23 342 364 342 364 0.98

11 15 0.0036 0.051 14.2 1.0 1 23 369 391 369 391 0.98

12 15 0.0095 0.13 12.8 1.7 1 23 396 418 396 418 0.98

13 15 0.014 0.19 12.3 0.9 1 23 423 445 423 445 0.98

14 15 0.0039 0.055 14.1 0.4 1 23 450 472 450 472 0.98

15 15 0.043 0.61 10.8 3.6 1 23 477 499 477 499 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	15	0.13	1.9	9.2	0.1	2	21	60	79	59	80	0.93
2	15	5.7	81	4.1	5.5	1	23	86	108	86	108	0.96
3	15	0.1	1.4	9.6	0.8	1	23	143	165	143	165	0.97
4	15	7.8e-05	0.0011	19.4	3.6	1	23	170	192	170	192	0.99
5	15	0.0031	0.043	14.4	1.2	1	23	197	219	197	219	0.99
6	15	0.00076	0.011	16.3	1.5	1	23	234	256	234	256	0.98
7	15	0.0017	0.024	15.2	0.2	1	23	261	283	261	283	0.98
8	15	0.0081	0.12	13.1	0.6	1	23	288	310	288	310	0.98
9	15	0.0069	0.098	13.3	0.6	1	23	315	337	315	337	0.98
10	15	0.013	0.19	12.4	3.6	1	23	342	364	342	364	0.98
11	15	0.0036	0.051	14.2	1.0	1	23	369	391	369	391	0.98
12	15	0.0095	0.13	12.8	1.7	1	23	396	418	396	418	0.98
13	15	0.014	0.19	12.3	0.9	1	23	423	445	423	445	0.98
14	15	0.0039	0.055	14.1	0.4	1	23	450	472	450	472	0.98
15	15	0.043	0.61	10.8	3.6	1	23	477	499	477	499	0.99

Sequence Information

Coding Sequence: ATGGATGCTGATTCCATTGaaagttgtgcaataaaatctgaagtgattttaacgGAAACTTTTTGTGGACAATATGGaggtTATGGGGCTGAACAACTAAAAACAGATCCAGTAGATTACGAAGAATATATTTCTGTAGAGCAGACTGGTGTGCATACTGTTCTCATGGAACAATTAtcttgtaatgaatgtgactttatGACAATGAAAAaagattctctaatagaacacCTGAAAATCGCCAACAATGTTCAATACTcttgtaaaaaatgtaactttacaacccGGTTACAGTGTTCCATAAAAAAGCATTTTGAGATTCACAAAGgtgtagataataaatacattattgaAGAAAGGAATCTTCAGACAACacagaatttttgtttaacacgGCAGTGGAAACCTTCAAAAAGTGGTGACAAATATATTtgcaatgaatgtaattataccacattAATCAAGAACTCTCTAAgaagacatgttaaaattcataaagaggctgaatataaatgtaaagaatgtgattataaaacggtgagAAAAGAACATCTAAAgcaacacgtcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaacagtgtggcaatatagtctaaagcaacatgtcagaattcatacaggtgatgagaaacatgtcaaaattcatacagatgacaaatatgagtgtaaagattgtgattataaaacaacatggaaaagttctctaaagaaacatgtcaaaattcatacagatcacaaatatgaatgtaaagattgtgattataaaacagcatggcaaagtgctctaaagcaacatgtcagaattcacacaggtgatgaatataagtgtaaacaatgtgattataaaacagtgtggcaagcTGATCTAaataaacatgtcaaaattcacactggttttgaatatgagtgtaaagaatgtgattataaaacagtgtggcaacaaagtctaaagcaacatatcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaacagtgttgCAACATAGTCTAAAAGAACacttcaaaattcatacaggtaatgaatatatgtgtaaagaatgtgattataaaacggcatGGAAAAGTtctctaaagaaacatgtcaaaattcatacagatgacaaatatgagtgtaaagattgtgattataaaacagcatgccAAAGTgctctaaagcaacatgtcaaaattcacacaggtgatgagtataagtgtaaacaatgtaattataaaacagtgtggcaagcTGATCTAaataaacatgtcaaaattcacactggtgatgaatataaatgtaaagaatgtgactataaaacagtgtggcaagcTGATCTAAATAAACATGTAAAAGTTCATACAgctgatgaatataagtgtaaagaatgtgattataaaacagtgtggaaaggtTGTCTAAAATCACATATTAAAAGACACAGGtga
Protein Sequence: MDADSIESCAIKSEVILTETFCGQYGGYGAEQLKTDPVDYEEYISVEQTGVHTVLMEQLSCNECDFMTMKKDSLIEHLKIANNVQYSCKKCNFTTRLQCSIKKHFEIHKGVDNKYIIEERNLQTTQNFCLTRQWKPSKSGDKYICNECNYTTLIKNSLRRHVKIHKEAEYKCKECDYKTVRKEHLKQHVKIHTGDEYKCKECDYKTVWQYSLKQHVRIHTGDEKHVKIHTDDKYECKDCDYKTTWKSSLKKHVKIHTDHKYECKDCDYKTAWQSALKQHVRIHTGDEYKCKQCDYKTVWQADLNKHVKIHTGFEYECKECDYKTVWQQSLKQHIKIHTGDEYKCKECDYKTVLQHSLKEHFKIHTGNEYMCKECDYKTAWKSSLKKHVKIHTDDKYECKDCDYKTACQSALKQHVKIHTGDEYKCKQCNYKTVWQADLNKHVKIHTGDEYKCKECDYKTVWQADLNKHVKVHTADEYKCKECDYKTVWKGCLKSHIKRHR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -