Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010000001.1:307426-309179[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 19 0.0017 0.024 15.2 1.3 1 23 64 86 64 86 0.98

2 19 0.038 0.54 10.9 1.3 1 23 91 113 91 113 0.98

3 19 1.4 20 6.0 2.8 2 23 119 140 118 140 0.97

4 19 0.0012 0.017 15.7 2.9 1 23 145 167 145 167 0.99

5 19 9.8 1.4e+02 3.4 3.3 1 23 172 194 172 194 0.89

6 19 5.6e-06 8e-05 23.0 1.4 1 23 199 221 199 221 0.99

7 19 0.0012 0.018 15.6 1.2 1 23 226 248 226 248 0.99

8 19 0.56 7.9 7.3 5.4 1 23 253 275 253 275 0.98

9 19 3.4e-06 4.9e-05 23.7 2.6 1 23 280 302 280 302 0.99

10 19 0.041 0.58 10.8 3.3 1 23 307 329 307 329 0.99

11 19 0.00097 0.014 16.0 1.1 1 23 334 356 334 356 0.99

12 19 9.8 1.4e+02 3.4 3.3 1 23 361 383 361 383 0.89

13 19 5.6e-06 8e-05 23.0 1.4 1 23 388 410 388 410 0.99

14 19 0.2 2.9 8.7 4.8 1 23 415 437 415 437 0.98

15 19 0.2 2.9 8.7 0.2 7 23 448 464 442 464 0.81

16 19 0.2 2.9 8.7 4.8 1 23 469 491 469 491 0.98

17 19 0.2 2.9 8.7 0.2 7 23 502 518 496 518 0.81

18 19 0.19 2.7 8.7 3.9 1 23 523 545 523 545 0.98

19 19 1.7 25 5.7 1.6 1 16 550 565 550 565 0.89

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	19	0.0017	0.024	15.2	1.3	1	23	64	86	64	86	0.98
2	19	0.038	0.54	10.9	1.3	1	23	91	113	91	113	0.98
3	19	1.4	20	6.0	2.8	2	23	119	140	118	140	0.97
4	19	0.0012	0.017	15.7	2.9	1	23	145	167	145	167	0.99
5	19	9.8	1.4e+02	3.4	3.3	1	23	172	194	172	194	0.89
6	19	5.6e-06	8e-05	23.0	1.4	1	23	199	221	199	221	0.99
7	19	0.0012	0.018	15.6	1.2	1	23	226	248	226	248	0.99
8	19	0.56	7.9	7.3	5.4	1	23	253	275	253	275	0.98
9	19	3.4e-06	4.9e-05	23.7	2.6	1	23	280	302	280	302	0.99
10	19	0.041	0.58	10.8	3.3	1	23	307	329	307	329	0.99
11	19	0.00097	0.014	16.0	1.1	1	23	334	356	334	356	0.99
12	19	9.8	1.4e+02	3.4	3.3	1	23	361	383	361	383	0.89
13	19	5.6e-06	8e-05	23.0	1.4	1	23	388	410	388	410	0.99
14	19	0.2	2.9	8.7	4.8	1	23	415	437	415	437	0.98
15	19	0.2	2.9	8.7	0.2	7	23	448	464	442	464	0.81
16	19	0.2	2.9	8.7	4.8	1	23	469	491	469	491	0.98
17	19	0.2	2.9	8.7	0.2	7	23	502	518	496	518	0.81
18	19	0.19	2.7	8.7	3.9	1	23	523	545	523	545	0.98
19	19	1.7	25	5.7	1.6	1	16	550	565	550	565	0.89

Sequence Information

Coding Sequence: atggatTTCGaatataatgaaagttatccgATAAAATCGGAAGTGgttgtaaatgaaacattttccttttgtgaaaaatatgaagatgATGGGAGTAAAGAATTGAAAGCGGAGCCAGTAGATTTCGAAGCAGGTTTTAAATCTGAAGGAGATAATGATATCGAGCAATCCAGTAGATCCAAATTTggatatatttgtaatgaatgtaattataaaacacggtGGAAATCGAATCTaacaaaacatgtaaaaattcatactgctgatgaatataaatgtaatgaatgtgactacaaaacaccatggaagaaCAGTTTTaacaaacatgtaaaaattcatactggtgatgaaaataagtgtaaggaatgtgacttcAAGACACCATGGAAGCACTATTTTaaggaacatataaaaattcatactggtgatgagtataaatgtaatgaatgtgactataaaacagtgagcaAATATCGTTTTAAAACacacataaaaattcatactggtgatgaatataagtgtaaggaatgtgacttcAAGACTCTATGGAAGCAGAATTTAAAGGTACAtgcaaaaattcatactggtggtgagtataaatgtaatgaatgtgactataaaacagtgaacaaaagtaattttaaagcacacatcaaaattcatactggtgatgagtataaatgtaatgaatgtgactataaaacagtgagcgAATATCGTTTTAAagcacacatcaaaattcatactggtgatgaatataagtgtaagcaATGTGACTTCAAGACAACATGGAAGCACTATTTTaaggaacatataaaaattcatactggtgatgagtataaatgtaatgaatgtgattttaaaacagcaagAAAAGATCATCTTAAAGCACACATGAGAAtccacactggtgatgaatataagtgtaaggaatgtaatttcAAGACACCATGGAAGCATAATTTTAAggcacatataaaaattcatactggtgatgagtataaatgtaatgaatgtgactataaaacagtgagcgCATATCGTTTTAAagtacacatcaaaattcatactggtgatgaatataagtgtaaagaatgtgacttcAAGACACTATGGAAGCAGAATTTAAAAGTTCAtgcaaaaattcatactggtagtgagtataaatgtaatgaatgtgactataaaacagtgaacaaaagtaattttaaagcacacatcaaaattcatactggcaatgaatataagtgtaaggaatgtgacttcAAGACAACATGGAAGCACTATTTTaaggaacatataaaaattcatactggtgatgagtataaatgtaatgaatatgACTTTAAAACAGCAAGAAAAGATCTTCTTAAAGCACACatgagaattcatactggtgatgaatataagtgtaaggaatgtgacttcAAGACAACATGGAAGCACTATTTTaaggaacatataaaaattcatactggtgatgagtataaatgtaatgaatatgACTTTAAAACAGCAAGAAAAGATCTTCTTAAAGCACACatgagaattcatactggtgatgaatataagtgtaaggaatgtgatttcaAGACACCATGGAAGCATAATTTTAAGGtacatacaaaaattcatactggtgatgagtataaatgtaatgaatgtgactataaaactgtaaacgaatatcatttttaa
Protein Sequence: MDFEYNESYPIKSEVVVNETFSFCEKYEDDGSKELKAEPVDFEAGFKSEGDNDIEQSSRSKFGYICNECNYKTRWKSNLTKHVKIHTADEYKCNECDYKTPWKNSFNKHVKIHTGDENKCKECDFKTPWKHYFKEHIKIHTGDEYKCNECDYKTVSKYRFKTHIKIHTGDEYKCKECDFKTLWKQNLKVHAKIHTGGEYKCNECDYKTVNKSNFKAHIKIHTGDEYKCNECDYKTVSEYRFKAHIKIHTGDEYKCKQCDFKTTWKHYFKEHIKIHTGDEYKCNECDFKTARKDHLKAHMRIHTGDEYKCKECNFKTPWKHNFKAHIKIHTGDEYKCNECDYKTVSAYRFKVHIKIHTGDEYKCKECDFKTLWKQNLKVHAKIHTGSEYKCNECDYKTVNKSNFKAHIKIHTGNEYKCKECDFKTTWKHYFKEHIKIHTGDEYKCNEYDFKTARKDLLKAHMRIHTGDEYKCKECDFKTTWKHYFKEHIKIHTGDEYKCNEYDFKTARKDLLKAHMRIHTGDEYKCKECDFKTPWKHNFKVHTKIHTGDEYKCNECDYKTVNEYHF

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -