Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010000001.1:856564-858090[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 14 0.78 11 6.8 0.3 1 23 93 115 93 115 0.97

2 14 0.0011 0.015 15.8 1.8 2 21 144 163 143 164 0.93

3 14 0.0014 0.02 15.5 2.9 1 23 168 190 168 190 0.98

4 14 0.045 0.64 10.7 2.9 1 23 195 217 195 217 0.98

5 14 0.0017 0.025 15.2 1.3 1 23 222 244 222 244 0.99

6 14 1.1e-05 0.00015 22.1 1.9 1 23 249 271 249 271 0.99

7 14 0.065 0.92 10.2 2.9 1 23 276 298 276 298 0.98

8 14 0.023 0.33 11.6 2.6 1 23 303 325 303 325 0.98

9 14 0.0052 0.074 13.7 1.9 1 23 330 352 330 352 0.98

10 14 0.0081 0.11 13.1 1.5 1 23 357 379 357 379 0.99

11 14 0.002 0.028 15.0 0.8 1 23 384 406 384 406 0.99

12 14 2.7e-05 0.00038 20.8 3.3 1 23 411 433 411 433 0.99

13 14 0.023 0.33 11.6 1.1 1 23 438 460 438 460 0.98

14 14 0.0049 0.069 13.7 2.2 1 23 465 487 465 487 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	14	0.78	11	6.8	0.3	1	23	93	115	93	115	0.97
2	14	0.0011	0.015	15.8	1.8	2	21	144	163	143	164	0.93
3	14	0.0014	0.02	15.5	2.9	1	23	168	190	168	190	0.98
4	14	0.045	0.64	10.7	2.9	1	23	195	217	195	217	0.98
5	14	0.0017	0.025	15.2	1.3	1	23	222	244	222	244	0.99
6	14	1.1e-05	0.00015	22.1	1.9	1	23	249	271	249	271	0.99
7	14	0.065	0.92	10.2	2.9	1	23	276	298	276	298	0.98
8	14	0.023	0.33	11.6	2.6	1	23	303	325	303	325	0.98
9	14	0.0052	0.074	13.7	1.9	1	23	330	352	330	352	0.98
10	14	0.0081	0.11	13.1	1.5	1	23	357	379	357	379	0.99
11	14	0.002	0.028	15.0	0.8	1	23	384	406	384	406	0.99
12	14	2.7e-05	0.00038	20.8	3.3	1	23	411	433	411	433	0.99
13	14	0.023	0.33	11.6	1.1	1	23	438	460	438	460	0.98
14	14	0.0049	0.069	13.7	2.2	1	23	465	487	465	487	0.99

Sequence Information

Coding Sequence: ATGGATGTTGATTCAATAGaaagttgtgcaataaaatccgaagtgattttaacagaaacatttgcgttttctggaaaatatgaagattgtggCGAGAGTGAAGAACCGAAAACAGAACTGGCAATTTATGaagaattgtttaaatgtaaagaagaaGATTCTGTAGAGCACATAGACATACGCGCTGCTCCATTGCAATGCATTAATGAAAGTAATTTTATGACAATGGAAAAGGATTATCAgatagaacatttgaaaattattaaaaatgttcaatattcttGTGAGGAATGTAACTTTATAACACAGTTAGAATCGTCCATAAAGgagcatttaaaaattcacaatgTAGTAGATGGTCAATATATTAccaaagaatgtaattttaaattgccAGTGCTGAAAACTGCAGGACTTCGCAATGAAtgcatttgtaatgaatgtaccTATACAACATTTGacaaaagtaatctaaagagacatataaaaattcaagacaaatataaatgtaaaaaatgtgactataaaacaaggaggaaaatttatctaaagggacatgtcaaaattcatatagatgatgaatataaatgtaaagattgtgattataaaactgtatggaaaaattgtctaaaggaacacatcaaaattcatacaggtgatgaatacaagtgtaaagaatgtgattataaaactgtgtggaaaaaaaatctaaaggaacacatcaaaattcatacaggtgataaatacaagtgtaaagaatgcgattataaaactatacagaaaagtaatctaaagcaacatgtcaaaattcataaaggtgatgaatataagtgtaaagaatgtgattataaaactgtatggaaaaattgtctaaaagaacatatcaaaattcatacgggtgatgaatataagtgtaaagaatgtgattataaaactgtgtggaaacatcaactaaaggaacatgtaaaaattcatacaggtgatgaatataagtgtaaaaaatgtgtttataagACATTGCGAAAAAGTCAACTAAAtgcacacatcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaactgtatggaaaaaatatctaaaggaacacatcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaacagtgtggaaaaatcaactaaaggcacacatcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaactgtacgaaaatatcaactaaagcAACATACCAGAATTCATACacgtgatgaatataagtgcaaagaatgtgattatagaacagTGTGGAAGAATCAACTAAATGCACacttcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaactgtatggaaaaaatatctaaaagaaCACATCAAAACTCATACAGGTGattaa
Protein Sequence: MDVDSIESCAIKSEVILTETFAFSGKYEDCGESEEPKTELAIYEELFKCKEEDSVEHIDIRAAPLQCINESNFMTMEKDYQIEHLKIIKNVQYSCEECNFITQLESSIKEHLKIHNVVDGQYITKECNFKLPVLKTAGLRNECICNECTYTTFDKSNLKRHIKIQDKYKCKKCDYKTRRKIYLKGHVKIHIDDEYKCKDCDYKTVWKNCLKEHIKIHTGDEYKCKECDYKTVWKKNLKEHIKIHTGDKYKCKECDYKTIQKSNLKQHVKIHKGDEYKCKECDYKTVWKNCLKEHIKIHTGDEYKCKECDYKTVWKHQLKEHVKIHTGDEYKCKKCVYKTLRKSQLNAHIKIHTGDEYKCKECDYKTVWKKYLKEHIKIHTGDEYKCKECDYKTVWKNQLKAHIKIHTGDEYKCKECDYKTVRKYQLKQHTRIHTRDEYKCKECDYRTVWKNQLNAHFKIHTGDEYKCKECDYKTVWKKYLKEHIKTHTGD

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -