Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010000001.1:5039878-5041573[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 14 0.015 0.21 12.2 1.3 1 23 140 162 140 162 0.97

2 14 0.0006 0.0085 16.6 0.8 1 21 194 214 194 215 0.95

3 14 6.4e-06 9.1e-05 22.8 1.5 1 23 221 243 221 243 0.99

4 14 0.0046 0.065 13.8 1.4 1 23 248 270 248 270 0.98

5 14 0.02 0.29 11.8 0.8 1 23 275 297 275 297 0.98

6 14 0.059 0.84 10.3 0.6 1 23 302 324 302 324 0.98

7 14 0.044 0.62 10.7 1.1 1 23 329 351 329 351 0.98

8 14 0.00041 0.0058 17.1 3.5 1 23 356 378 356 378 0.98

9 14 0.00083 0.012 16.2 2.4 1 23 383 405 383 405 0.99

10 14 0.00016 0.0023 18.4 4.0 1 23 410 432 410 432 0.99

11 14 0.032 0.45 11.2 1.8 1 23 437 459 437 459 0.98

12 14 0.011 0.16 12.6 6.6 1 23 464 486 464 486 0.99

13 14 5.9e-05 0.00084 19.8 1.9 1 23 491 513 491 513 0.99

14 14 0.0002 0.0028 18.1 2.2 1 23 518 540 518 540 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	14	0.015	0.21	12.2	1.3	1	23	140	162	140	162	0.97
2	14	0.0006	0.0085	16.6	0.8	1	21	194	214	194	215	0.95
3	14	6.4e-06	9.1e-05	22.8	1.5	1	23	221	243	221	243	0.99
4	14	0.0046	0.065	13.8	1.4	1	23	248	270	248	270	0.98
5	14	0.02	0.29	11.8	0.8	1	23	275	297	275	297	0.98
6	14	0.059	0.84	10.3	0.6	1	23	302	324	302	324	0.98
7	14	0.044	0.62	10.7	1.1	1	23	329	351	329	351	0.98
8	14	0.00041	0.0058	17.1	3.5	1	23	356	378	356	378	0.98
9	14	0.00083	0.012	16.2	2.4	1	23	383	405	383	405	0.99
10	14	0.00016	0.0023	18.4	4.0	1	23	410	432	410	432	0.99
11	14	0.032	0.45	11.2	1.8	1	23	437	459	437	459	0.98
12	14	0.011	0.16	12.6	6.6	1	23	464	486	464	486	0.99
13	14	5.9e-05	0.00084	19.8	1.9	1	23	491	513	491	513	0.99
14	14	0.0002	0.0028	18.1	2.2	1	23	518	540	518	540	0.98

Sequence Information

Coding Sequence: ATGGATATCGACTCGGTagactttgttgaaaattgtgctataaaatcagaagtaattttaacagagacattttctttttgtgggaagTACGAAGaTTATGCTAGTAAGGAACTGAAACCGGAACctgtaaattacaaaatatggattAAAcccaaagaagaaaatgatctaGCAGAACCCATAGCTTCACATgcttttaaaacaattgaagaaaatgcTGTAATAGAAGTTTCGAAACTTACCAAAAGTTCTAAATACttttgtaaggaatgtaactttacaactGAATTAGAATGTTCTATAAAAGAGCATAATCGGATTCACACTGATGaatataatattgaagaatgtaaATTTAAGATGCCACAGATTTTATCTCTATCATCACAGTCGAAATATTCAAATAGTGGGAATCAATAtgcttgtaatgaatgtaattacaccacattgaacaaaaattatctaaGGAAACATGTGAAGATTCACAAAGGTGAAACATATAGTAGCAAGAAATTTGACTGTAATACAGGGTGGAAAAGTCACTTCACAGCACATggaaaaattcatactggtgacaaatataagtgtaaagaatgtgattatgaaactgtacggaaaagttatctaaaggaacacgtcaaaaatcgtacaggtgatgaatataagtgtaaagaatgtgattataaaacggtacggAGAAGTGATCTAAtgaaacacatcaaaattcatagagatgatgaatataagtgtaaagaatgtgattataaaacggcatggaaaagtaatctaatgcaacacgTCAAAtatcatacaggtgatgaatataagtgtaaagaatgtgattataaaacggtatggaaacgTGATCTAATgcaacacgtcaaaattcatactggtgacaaatataagtgtaaagaatgtgattataaaacggtatggaaaagtgtcctaatgcaacatgtcaaaattcatactggtgaggaatataagtgtaaagaatgtaattataaaactatatggaaaagagacctaatgcaacatgtcaaaattcatacaggtgaggaacataagtgtaaagagtgtgattataaaactatacggAAAAGTTacctaaaggaacatgtcaaaattcatacaggtgaggaatataagtgtaaaaattgtgattataaaactatacggaaaaattacctaatgcaacatgtcaaaattcatacaggtgaggagtataagtgtaaagagtgtcaTTATAAAACTATACGGAAAAGTTACCTAAAagcacatgtcaaaattcatacaggcgatgaatataagtgtaaagaatgtgattataaaacaatatggaaaagtcATTTAATGGAACATggcaaaattcatacaggtgatgaatataagtgtaaagaatgtaattataaaactgtacggaaacattgtctaatgcaacatgtcaaaattcatactggtaacaaatataagtgtaaagaatgtgattataaaactatacggAAAAGTTACCttaaggaacatgtcaaaattcatactggtgatgaatataagtgtaaagaatgtaattataaaactatacgGAAAAGTTACCTTAAGGAACatgctaaaattcatacagtTGAGGAACATAAGTga
Protein Sequence: MDIDSVDFVENCAIKSEVILTETFSFCGKYEDYASKELKPEPVNYKIWIKPKEENDLAEPIASHAFKTIEENAVIEVSKLTKSSKYFCKECNFTTELECSIKEHNRIHTDEYNIEECKFKMPQILSLSSQSKYSNSGNQYACNECNYTTLNKNYLRKHVKIHKGETYSSKKFDCNTGWKSHFTAHGKIHTGDKYKCKECDYETVRKSYLKEHVKNRTGDEYKCKECDYKTVRRSDLMKHIKIHRDDEYKCKECDYKTAWKSNLMQHVKYHTGDEYKCKECDYKTVWKRDLMQHVKIHTGDKYKCKECDYKTVWKSVLMQHVKIHTGEEYKCKECNYKTIWKRDLMQHVKIHTGEEHKCKECDYKTIRKSYLKEHVKIHTGEEYKCKNCDYKTIRKNYLMQHVKIHTGEEYKCKECHYKTIRKSYLKAHVKIHTGDEYKCKECDYKTIWKSHLMEHGKIHTGDEYKCKECNYKTVRKHCLMQHVKIHTGNKYKCKECDYKTIRKSYLKEHVKIHTGDEYKCKECNYKTIRKSYLKEHAKIHTVEEHK

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -