Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010002119.1:2474607-2476118[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 15 0.0029 0.041 14.5 1.6 1 23 74 96 74 96 0.99

2 15 0.067 0.95 10.2 3.0 1 23 101 123 101 123 0.98

3 15 9.5e-05 0.0013 19.1 0.4 1 23 128 150 128 150 0.98

4 15 0.001 0.015 15.9 2.3 1 23 155 177 155 177 0.97

5 15 0.0023 0.032 14.8 1.8 1 23 182 204 182 204 0.99

6 15 0.034 0.48 11.1 1.5 1 23 209 231 209 231 0.98

7 15 0.032 0.45 11.2 0.5 1 23 236 258 236 258 0.96

8 15 0.001 0.015 15.9 1.2 1 23 263 285 263 285 0.99

9 15 0.02 0.28 11.9 1.7 1 23 290 312 290 312 0.99

10 15 0.00013 0.0019 18.7 0.8 1 23 317 339 317 339 0.98

11 15 0.015 0.22 12.2 1.5 1 23 344 366 344 366 0.97

12 15 0.0024 0.035 14.7 1.4 1 23 371 393 371 393 0.99

13 15 0.16 2.2 9.0 0.7 1 23 398 420 398 420 0.96

14 15 0.00047 0.0066 17.0 1.6 1 23 425 447 425 447 0.98

15 15 0.085 1.2 9.8 0.7 1 23 452 474 452 474 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	15	0.0029	0.041	14.5	1.6	1	23	74	96	74	96	0.99
2	15	0.067	0.95	10.2	3.0	1	23	101	123	101	123	0.98
3	15	9.5e-05	0.0013	19.1	0.4	1	23	128	150	128	150	0.98
4	15	0.001	0.015	15.9	2.3	1	23	155	177	155	177	0.97
5	15	0.0023	0.032	14.8	1.8	1	23	182	204	182	204	0.99
6	15	0.034	0.48	11.1	1.5	1	23	209	231	209	231	0.98
7	15	0.032	0.45	11.2	0.5	1	23	236	258	236	258	0.96
8	15	0.001	0.015	15.9	1.2	1	23	263	285	263	285	0.99
9	15	0.02	0.28	11.9	1.7	1	23	290	312	290	312	0.99
10	15	0.00013	0.0019	18.7	0.8	1	23	317	339	317	339	0.98
11	15	0.015	0.22	12.2	1.5	1	23	344	366	344	366	0.97
12	15	0.0024	0.035	14.7	1.4	1	23	371	393	371	393	0.99
13	15	0.16	2.2	9.0	0.7	1	23	398	420	398	420	0.96
14	15	0.00047	0.0066	17.0	1.6	1	23	425	447	425	447	0.98
15	15	0.085	1.2	9.8	0.7	1	23	452	474	452	474	0.98

Sequence Information

Coding Sequence: ATGGATGTGAATTATAGTGAATGCTGTTCGATAAAATCAGAAGTAATCGTAGAGGAAACGTTTTCGTTTTGTGGGAAACatgaagATTATGCGAATGAAGACCTGAAAACGGAGGTAGTAGGTTtcgaagaatcttttaaatacgATGAAGAGAATTTGGCGAAATGTGATTATTATATGCCATGGACACAGCTTCTAAAAGcacatacaggtaatgaatataaatgtaaggaatgtgattataaatcacGGTGGAAACGAGCTTTAAaccaacatatgaaaattcacactggtgatgaatataaatgtaagcaatgtgattataaaacacggtGGAAACGGACTTTAAGTCAACATctgaaaattcacactggtgatgaatacaagtgtaacgaatgtgattataaaactgtaaggGCTGGCGATCTAAAACAACATGAGAAAGTGCAcactggtgacgaatataagtgtaacgaatgtaattataaaacattgagGAGAAGTGATCTAAAGCAACATATGAAAGGACacactggtaatgaatataagtgtaatgaatgtgattataaaacacggtGGAAACGGGGTTTAAagcaacatatgaaaattcacactggtgacgaatataagtgtaacgaatgtgattataaaacaagatgGAAATCAATTTTAAgcaaacatatgaaaattcatgctggtgatgaatacaagtgtaatgaatgtgattataaaacattgaagGCTGGtgatctaaagcaacatgtgaaAGGGCacactggtaatgaatataggtgtaatgaatgtgattataaaacacggtTGAAACGAGCTTTAGaccaacatatgaaaattcacactggtgacgaatataaatgtaaggaatgtgattataaagcaCGGTGGAAACGGACTTTAAGccaacatatgaaaattcacactggcGACGAATACAAGTGTaacaaatgtgattataaaaccgtGAGAGCTGGTGATCTAAAACAACACGAGAAAGtccacactggtgatgaatataagtgtaatgaatgtgattataaaacattgaggAGAAATGATCTAAAACAACATGTGAAAGGACacactggtaatgaatataagtgcaatgaatgtgattataaaacacggtGGAAACGGGGTTTAAaccaacatatgaaaattcacactggtgatgaatataagtgtaacgaatgtgattataaaacaaggtGGAAACCGATTTTAAGCCAACATATGAGAATTCACACTGGTGAGGAATacaagtgtaatgaatgtgattataaaacagtgaagGCTGgtcatctaaagcaacatgtgaaAGGGCACACTGGTGAtgtatataagtgtaatgaatgtgattataaaacatggtTGAAACGAGCTTTAGaccaacatatgaaaattcacactggtgacgaatataaatgtgatggaatgtga
Protein Sequence: MDVNYSECCSIKSEVIVEETFSFCGKHEDYANEDLKTEVVGFEESFKYDEENLAKCDYYMPWTQLLKAHTGNEYKCKECDYKSRWKRALNQHMKIHTGDEYKCKQCDYKTRWKRTLSQHLKIHTGDEYKCNECDYKTVRAGDLKQHEKVHTGDEYKCNECNYKTLRRSDLKQHMKGHTGNEYKCNECDYKTRWKRGLKQHMKIHTGDEYKCNECDYKTRWKSILSKHMKIHAGDEYKCNECDYKTLKAGDLKQHVKGHTGNEYRCNECDYKTRLKRALDQHMKIHTGDEYKCKECDYKARWKRTLSQHMKIHTGDEYKCNKCDYKTVRAGDLKQHEKVHTGDEYKCNECDYKTLRRNDLKQHVKGHTGNEYKCNECDYKTRWKRGLNQHMKIHTGDEYKCNECDYKTRWKPILSQHMRIHTGEEYKCNECDYKTVKAGHLKQHVKGHTGDVYKCNECDYKTWLKRALDQHMKIHTGDEYKCDGM

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -