Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010002652.1:76214-77786[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 14 0.0095 0.13 12.8 4.7 2 23 122 143 121 143 0.96

2 14 1.3e-05 0.00018 21.9 1.0 1 23 148 170 148 170 0.98

3 14 0.044 0.62 10.8 0.5 1 23 175 197 175 197 0.98

4 14 0.056 0.79 10.4 0.2 1 23 202 224 202 224 0.98

5 14 0.013 0.18 12.4 0.9 1 23 229 251 229 251 0.98

6 14 0.7 9.9 7.0 2.3 1 23 255 277 255 277 0.96

7 14 0.022 0.32 11.7 4.0 1 23 282 304 282 304 0.98

8 14 7.7e-05 0.0011 19.4 0.9 2 23 311 332 310 332 0.98

9 14 0.00036 0.005 17.3 0.7 1 23 337 359 337 359 0.99

10 14 0.0057 0.081 13.5 0.5 1 23 364 386 364 386 0.99

11 14 0.0019 0.027 15.0 1.6 1 23 391 413 391 413 0.99

12 14 1.1e-05 0.00015 22.1 1.4 1 23 418 440 418 440 0.98

13 14 1.3e-05 0.00019 21.8 1.3 1 23 445 467 445 467 0.99

14 14 9.3e-05 0.0013 19.2 1.7 1 23 472 494 472 494 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	14	0.0095	0.13	12.8	4.7	2	23	122	143	121	143	0.96
2	14	1.3e-05	0.00018	21.9	1.0	1	23	148	170	148	170	0.98
3	14	0.044	0.62	10.8	0.5	1	23	175	197	175	197	0.98
4	14	0.056	0.79	10.4	0.2	1	23	202	224	202	224	0.98
5	14	0.013	0.18	12.4	0.9	1	23	229	251	229	251	0.98
6	14	0.7	9.9	7.0	2.3	1	23	255	277	255	277	0.96
7	14	0.022	0.32	11.7	4.0	1	23	282	304	282	304	0.98
8	14	7.7e-05	0.0011	19.4	0.9	2	23	311	332	310	332	0.98
9	14	0.00036	0.005	17.3	0.7	1	23	337	359	337	359	0.99
10	14	0.0057	0.081	13.5	0.5	1	23	364	386	364	386	0.99
11	14	0.0019	0.027	15.0	1.6	1	23	391	413	391	413	0.99
12	14	1.1e-05	0.00015	22.1	1.4	1	23	418	440	418	440	0.98
13	14	1.3e-05	0.00019	21.8	1.3	1	23	445	467	445	467	0.99
14	14	9.3e-05	0.0013	19.2	1.7	1	23	472	494	472	494	0.97

Sequence Information

Coding Sequence: ATGGACGtcaaatataatgaaaattatccaataaaatcagaagtgattgTAAATGAGACATTTTCCTATTGTGGAAAATCTGAAGATTACGAgaatgaagaattgaaaatgGAGCAGGTGGATATGGAAGAATCTCTTAAATACGAAGAAGATAATCTTGTGGAGCTTACTGATATGCATGGTGCAGCCATACATCGTTACGTTTGtaatgaatataattttattaaaactgagaaagattctctaatagaaaatttggaaataactaaaaatattcaatatgtTTTTAAGGAATATGATTTAAAAACACAGTGGCAAACTAGTCTAACGGAAAATGCACAAATTAATGCTGGTGATGAATGTAAGTGTATGGAATGTGACTATAGAGCGGCGAGCAAAGATTGTCTAaaaaaacatatgaaaattcatagagGTGAAGAATATGAGTGTACTGAATGTGTCTATAAAACAGTAAGAAAAGATAATCTACAaagacatatgaaaattcataaaggtgagAAATATGAGTGTACCAAATGTGTCTATAAAACAGCGAGGAAAGATATTTTAAaggaacatattaaaattcatacaggtgatgaatacaagtgtaatgaatgtgattacaaaacacctTGGAAACGAGGCTTAATggtacatgtaaaaattcatagtggtgatgaatataactgtaaattatgtaattataaaacaccattagaacagaatctaaagaaacatgtgaaTATTCATACTTATGAACATAATTGTagtgaatgtgattttaaaacaccatggaaacaaaaACTAAAGCAACATATAAAGATTCATACTGgcgaaaaatataaatgtaaacaatgttactatcaaacatcattgaaacaaaatctaaagaaacatgtaaaacttcattgtgaaaataaatataataagtgTAGTGAATGTGAATATATAACTGTGAGGAAAGATAGTCTAAGgagacatatgaaaattcatacagataatgaatataaatgcaacgaatgtgactataaaacagggAGGAAAGGTGTTTTAAAGCagcatattaaaattcatacatctgatgaatataagtgtaatgaatgcgactataaaacaccatggaaacgaAGTCTAAACatacacataaaaattcatactgataaTGCATATAAGTGTagtgaatgtgattataaaacaacatggaaacagaatctacagaaacatgtgaaaattcatggAGGTGAAGAATATgattgtaatgaatgtgattataaaacgtcATCACAATATAATCTAAAcaagcatttgaaaattcatagagGAAAAGAATACAAGTGTACTGAATGTGTGTATAATACAGTAAGGAAAGATAATTTACAgagacatatgaaaattcatagagATAAGAAGTATGactgtaataaatgtgattataaaacagtgaggaaagatACATTAAAAagacatgtgaaaattcatactgacgaaaagtataataataatattgtttattaa
Protein Sequence: MDVKYNENYPIKSEVIVNETFSYCGKSEDYENEELKMEQVDMEESLKYEEDNLVELTDMHGAAIHRYVCNEYNFIKTEKDSLIENLEITKNIQYVFKEYDLKTQWQTSLTENAQINAGDECKCMECDYRAASKDCLKKHMKIHRGEEYECTECVYKTVRKDNLQRHMKIHKGEKYECTKCVYKTARKDILKEHIKIHTGDEYKCNECDYKTPWKRGLMVHVKIHSGDEYNCKLCNYKTPLEQNLKKHVNIHTYEHNCSECDFKTPWKQKLKQHIKIHTGEKYKCKQCYYQTSLKQNLKKHVKLHCENKYNKCSECEYITVRKDSLRRHMKIHTDNEYKCNECDYKTGRKGVLKQHIKIHTSDEYKCNECDYKTPWKRSLNIHIKIHTDNAYKCSECDYKTTWKQNLQKHVKIHGGEEYDCNECDYKTSSQYNLNKHLKIHRGKEYKCTECVYNTVRKDNLQRHMKIHRDKKYDCNKCDYKTVRKDTLKRHVKIHTDEKYNNNIVY

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -