Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010001931.1:2384292-2386167[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 18 0.25 3.5 8.4 0.0 2 21 69 88 68 89 0.93

2 18 0.73 10 6.9 0.6 1 23 152 174 152 174 0.96

3 18 0.00039 0.0055 17.2 1.3 1 23 179 201 179 201 0.99

4 18 0.029 0.42 11.3 0.5 1 23 206 228 206 228 0.98

5 18 6.3e-05 0.00089 19.7 3.2 1 23 233 255 233 255 0.99

6 18 0.0014 0.019 15.5 0.7 1 23 260 282 260 282 0.99

7 18 0.00017 0.0024 18.3 3.6 1 23 287 309 287 309 0.99

8 18 0.027 0.38 11.4 0.8 1 23 314 336 314 336 0.98

9 18 0.041 0.58 10.8 0.4 1 23 341 363 341 363 0.98

10 18 0.00081 0.012 16.2 0.9 1 23 368 390 368 390 0.97

11 18 0.006 0.084 13.5 0.5 1 23 395 417 395 417 0.98

12 18 0.045 0.64 10.7 0.5 1 23 422 444 422 444 0.98

13 18 0.046 0.65 10.7 1.4 1 23 449 471 449 471 0.98

14 18 0.00034 0.0048 17.4 3.2 1 23 476 498 476 498 0.98

15 18 3.4 48 4.8 0.9 1 23 503 525 503 525 0.74

16 18 0.00045 0.0063 17.0 1.5 1 23 530 552 530 552 0.99

17 18 0.00022 0.0032 18.0 1.3 1 23 557 579 557 579 0.98

18 18 0.0017 0.024 15.2 1.5 1 23 584 606 584 606 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	18	0.25	3.5	8.4	0.0	2	21	69	88	68	89	0.93
2	18	0.73	10	6.9	0.6	1	23	152	174	152	174	0.96
3	18	0.00039	0.0055	17.2	1.3	1	23	179	201	179	201	0.99
4	18	0.029	0.42	11.3	0.5	1	23	206	228	206	228	0.98
5	18	6.3e-05	0.00089	19.7	3.2	1	23	233	255	233	255	0.99
6	18	0.0014	0.019	15.5	0.7	1	23	260	282	260	282	0.99
7	18	0.00017	0.0024	18.3	3.6	1	23	287	309	287	309	0.99
8	18	0.027	0.38	11.4	0.8	1	23	314	336	314	336	0.98
9	18	0.041	0.58	10.8	0.4	1	23	341	363	341	363	0.98
10	18	0.00081	0.012	16.2	0.9	1	23	368	390	368	390	0.97
11	18	0.006	0.084	13.5	0.5	1	23	395	417	395	417	0.98
12	18	0.045	0.64	10.7	0.5	1	23	422	444	422	444	0.98
13	18	0.046	0.65	10.7	1.4	1	23	449	471	449	471	0.98
14	18	0.00034	0.0048	17.4	3.2	1	23	476	498	476	498	0.98
15	18	3.4	48	4.8	0.9	1	23	503	525	503	525	0.74
16	18	0.00045	0.0063	17.0	1.5	1	23	530	552	530	552	0.99
17	18	0.00022	0.0032	18.0	1.3	1	23	557	579	557	579	0.98
18	18	0.0017	0.024	15.2	1.5	1	23	584	606	584	606	0.98

Sequence Information

Coding Sequence: atggatgttgattctattgaaaattgtgcaataaaatctgaagtaattttaacagaaacgtttACTTTTTGTGAACAATACAGAGATTATGgagataaaaaactaaaaacagagcCAGTAGATTATGAAGATCCttttaaatgtaaggaagaagATATTTCTATAGAGCAGACGAACATGCATGCTTCTCACATGCAACAACTTTCTTGTAATGAGTGTGACTTTATGACAGTTGAAAAAGGTTCGCTAATAGAACacttaaaaattactaaaaatgttcaatattcttGTAAGGAGTGTAACTTCACAACCCAGTTACAATGTTCCTTAAAAAAgcattttgattttcacaaagGGGAAGatgataaatatattattaaagacTGTAATTTTCAGACATCTcagaatttttctttaacaccaCAGTGGAAAACTTCAAAAAGTGGTGAcatatatatttgtaatgaatgtaattataccacattAATCAAAAGGTATCTAAGAGggcatattaaaattcataaaggggctgaatataagtgtaacgaatgtgactataaaactgtgCGGAAAGACCGGCTAaaggatcatgtcaaaattcatacaggtgataaatataagtgtgaagaatgtgattataaaacaatatggaaatatCTTctgaaggaacatgtcaaaattcatacaggtgatgaatataaatgtaaagaatgtgattataaaacagtgcgaaaagatcatCTAAAtcaacatgtgaaaattcatactggtgataaatataagtgtaaagaatgtgattttaaaacggcatggcaaagtaatctaaaggaacatatcaaaatccacagaggtgacaaatataagtgtaatgaatgtgactataaaacagtgcgaaaacgTCATCTAAAtcaacatgtgaaaattcatataggcgatgaatataagtgcacagaatgtgattataaaacagtatggaaaaatcttctaaaggatcatctcaaaattcataccggtgatgaatataagtgtaatgaatgtgattataaaacagcatggcaaaatagtctaaaggaacatgccaaaattcatacaggtgatgaatataaatgtatagaatgtgactataaaacagtgagaaaaagTAATCTCaatcaacatgtaaaaattcatacaggtgatgaatataagtgtaacgaatgtgattataaaacagcatggcaaagTAGCCTAAAactacatgtcaaaattcatgcaggtgagaaatatgaatgtaaagaatgtgattataaaacagcatggcaacGGAGTCTAAAgctacatgtcaaaattcatacaggtgacaaatatgagtgtaaggaatgtgattataaaacagcatggcaaagttgtctaaaggaacatgtcaaaattcatacaggcgatgaacaCAAGTGTGAAGACtgcaactataaaacagtgagaaaaagttatctaaatcaacatgtcaaaattcatacgggtgatgaatataagtgtaaagaatgtgattataaaacaatatggaaaaatcgTGTAAAAGAACatgccaaaattcatacaggtgatgaatataaatgtaaagaatgtgactataaaacagtgcgaaaagatcgtctaaaggaacacgtcaaaattcatacaggtcatgaatatatgtgtaaagaatgtgaatataaaacagtGTCGCAAAATTCTCTaaagaaacatatcaaaattcatacaggtgatgaatatatgtgtaaagaatgtgattataaaacagtgtggcaaagttCTCTAAAGAAACATATCAAAAGACACACGTGA
Protein Sequence: MDVDSIENCAIKSEVILTETFTFCEQYRDYGDKKLKTEPVDYEDPFKCKEEDISIEQTNMHASHMQQLSCNECDFMTVEKGSLIEHLKITKNVQYSCKECNFTTQLQCSLKKHFDFHKGEDDKYIIKDCNFQTSQNFSLTPQWKTSKSGDIYICNECNYTTLIKRYLRGHIKIHKGAEYKCNECDYKTVRKDRLKDHVKIHTGDKYKCEECDYKTIWKYLLKEHVKIHTGDEYKCKECDYKTVRKDHLNQHVKIHTGDKYKCKECDFKTAWQSNLKEHIKIHRGDKYKCNECDYKTVRKRHLNQHVKIHIGDEYKCTECDYKTVWKNLLKDHLKIHTGDEYKCNECDYKTAWQNSLKEHAKIHTGDEYKCIECDYKTVRKSNLNQHVKIHTGDEYKCNECDYKTAWQSSLKLHVKIHAGEKYECKECDYKTAWQRSLKLHVKIHTGDKYECKECDYKTAWQSCLKEHVKIHTGDEHKCEDCNYKTVRKSYLNQHVKIHTGDEYKCKECDYKTIWKNRVKEHAKIHTGDEYKCKECDYKTVRKDRLKEHVKIHTGHEYMCKECEYKTVSQNSLKKHIKIHTGDEYMCKECDYKTVWQSSLKKHIKRHT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -