Lyun005068.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Lamprigera yunnana
Gene Symbol
-
Assembly
GCA_013368075.1
Location
JABVZV010000868.1:6158712-6160346[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 16 0.00018 0.0025 18.3 1.4 1 23 93 115 93 115 0.98
2 16 0.0066 0.093 13.3 0.7 1 23 125 147 125 147 0.98
3 16 0.0062 0.088 13.4 1.9 1 23 152 174 152 174 0.98
4 16 0.009 0.13 12.9 0.9 1 23 179 201 179 201 0.97
5 16 0.0016 0.023 15.3 0.9 1 23 206 228 206 228 0.99
6 16 0.0014 0.019 15.5 0.9 1 23 233 255 233 255 0.99
7 16 0.00088 0.012 16.1 1.5 1 23 260 282 260 282 0.99
8 16 0.00038 0.0054 17.2 1.3 1 23 287 309 287 309 0.98
9 16 0.0058 0.082 13.5 2.2 1 23 314 336 314 336 0.99
10 16 0.00058 0.0082 16.7 0.9 1 23 341 363 341 363 0.97
11 16 0.0019 0.027 15.1 0.7 1 23 368 390 368 390 0.98
12 16 0.0014 0.019 15.5 0.9 1 23 395 417 395 417 0.99
13 16 0.0032 0.045 14.3 0.6 1 23 422 444 422 444 0.98
14 16 7.2e-05 0.001 19.5 1.2 1 23 449 471 449 471 0.99
15 16 3.5 50 4.8 1.2 1 23 476 498 476 498 0.96
16 16 0.0046 0.065 13.8 1.6 1 23 503 525 503 525 0.98

Sequence Information

Coding Sequence
ATGGATGTTGATTCagtagaaaattttcaaataaaatctgaattgattttaacagaaacattttcgtTTTCTGGAAAATACGACGattgtgaGAGTCAAGAACCGAAAACGGAATCAACAGTTTATGaagatttgtttaaatgtaaaaaagaagATTATGTAGAGTACTTTGAAATACACAGTGCTCCGACtcaatgtattaatgaatgtaattttgagaTGCCAAGCATTTTCTCTTTAACATCAGATCTCAAAACTCCAAGAATTTGCAACgaatacatttgtaatgaatgtaattataccacattCCTCAAAAATAATCTAAGGAGGCATATAAGAATTCATAAAGGTGATGACTATACttgtgacaaatataagtgtaaagaatgtgagtataaaacagtgtggaaaagtaatctaaatgaacatgttaaaattcatacaggcgataaatataagtgtacagaatgtgattataaaacagtgtggaaaggtCATCTTaacaaacatgtcaaaattcatacaggtgatgaatataagtgtatagaatgtgattataaaacagtgcggaaaaatcaactgaaggaacatgtcaaaattcatacaggtgatgaatataagtgcaaagaatgtgattataaaacagtgtggaaaagtaatctaaaggaacatgtcaaaattcatacaggcgataaatataagtgtaaagagtgtgattacagaacagtgtggaaaagtaatctaaaagaacatgtcaaaattcatacaggcgataaatataagtgtaaagaatgtgattataaaacagtgtggaaaagtaatctaaaggaacatgtcaaaactcATATAGGGgataaatatgagtgtaaagaatgtgattataaaacagtacggaaaaataaactaaaggaacatgtcaaaattcatacaggcgatgaatataagtgtaaagaatgtgattataaaacagtgtggaaaggtCATCTTaacaaacatgtcaaaattcatacaggtgatgaatataagtgtatagaatgtgattataaaacagtgcggaaaagtcaattaaaggaacatatcaaaattcatacaggcgatgaatataagtgtaaagaatgtgattataaaacagtgtggaaaagtaatctaaatgaacatgtaaaaattcatacaggtaatgaatataagtgtaaagaatgtgattacagaacagtgtggaaaagtaatctaaaggaacatgtcaaaattcatacaggcgataaatataagtgtcaagaatgtgattataaaacagtgtggaaaagtaatctaaatgagcatgtcaaaattcataccggtaatgaatataagtgtaaagaatgtgattataaaacagtacggaaaggtctactaaagcaacatgtcaaaattcatacaggtaatgaatataagtgtatagaatgtcattataaaacagtgtggaaggGTAATCTAAATGAACATGTCAAACTTCATAcgggtaatgaatataagtgtaaagaatgtgattataagactgtgtggaaaaatcaactgaagcgacatgtcaaaattcataattga
Protein Sequence
MDVDSVENFQIKSELILTETFSFSGKYDDCESQEPKTESTVYEDLFKCKKEDYVEYFEIHSAPTQCINECNFEMPSIFSLTSDLKTPRICNEYICNECNYTTFLKNNLRRHIRIHKGDDYTCDKYKCKECEYKTVWKSNLNEHVKIHTGDKYKCTECDYKTVWKGHLNKHVKIHTGDEYKCIECDYKTVRKNQLKEHVKIHTGDEYKCKECDYKTVWKSNLKEHVKIHTGDKYKCKECDYRTVWKSNLKEHVKIHTGDKYKCKECDYKTVWKSNLKEHVKTHIGDKYECKECDYKTVRKNKLKEHVKIHTGDEYKCKECDYKTVWKGHLNKHVKIHTGDEYKCIECDYKTVRKSQLKEHIKIHTGDEYKCKECDYKTVWKSNLNEHVKIHTGNEYKCKECDYRTVWKSNLKEHVKIHTGDKYKCQECDYKTVWKSNLNEHVKIHTGNEYKCKECDYKTVRKGLLKQHVKIHTGNEYKCIECHYKTVWKGNLNEHVKLHTGNEYKCKECDYKTVWKNQLKRHVKIHN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-