Basic Information

Gene Symbol
-
Assembly
GCA_013368075.1
Location
JABVZV010000001.1:339259-341292[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 19 3 43 5.0 0.6 1 23 92 114 92 114 0.94
2 19 0.0027 0.038 14.6 1.4 1 23 142 164 142 164 0.98
3 19 0.0013 0.018 15.6 2.8 1 23 171 193 171 193 0.99
4 19 0.00084 0.012 16.2 0.6 1 23 198 220 198 220 0.99
5 19 0.085 1.2 9.8 2.7 1 23 225 247 225 247 0.97
6 19 0.00019 0.0027 18.2 0.8 1 23 252 274 252 274 0.99
7 19 0.0068 0.097 13.3 3.6 1 23 279 301 279 301 0.98
8 19 1.3e-05 0.00019 21.8 2.0 1 23 306 328 306 328 0.99
9 19 0.085 1.2 9.8 0.9 1 23 333 355 333 355 0.98
10 19 0.0051 0.073 13.7 0.4 1 23 360 382 360 382 0.98
11 19 0.14 1.9 9.2 1.0 1 23 387 409 387 409 0.98
12 19 0.00026 0.0037 17.7 3.5 1 23 414 436 414 436 0.99
13 19 0.015 0.21 12.2 0.4 1 23 441 463 441 463 0.97
14 19 0.016 0.22 12.2 1.3 1 23 468 490 468 490 0.98
15 19 0.00086 0.012 16.1 2.3 1 23 523 545 523 545 0.99
16 19 9.7e-05 0.0014 19.1 3.1 1 23 550 572 550 572 0.99
17 19 7.7e-05 0.0011 19.4 2.0 1 23 577 599 577 599 0.99
18 19 0.00034 0.0049 17.4 1.3 1 23 604 626 604 626 0.99
19 19 0.3 4.2 8.1 2.9 1 23 631 653 631 653 0.98

Sequence Information

Coding Sequence
atggatGTTGATTCAACAGAgagttgtgcaataaaatccgaaatgattttaacagaaacatttatGTTTTCTGGATATAACGAAGatTATGAATGTCGAGAACCGAAAACGGAACCAGCAGTTTATGaagaattgtttaaatgtaaagaagaaGATTCTGCAGAATACATAGACATACAAGCTGCTTCGATGCAATCtattaatgaatgtaattttacgacaATCGAAAAGAATTGTCTtatagaacatttgaaaattactaaaaatgattatttttcttgtgaggaatgtaactttacaacgCTGTTAGAATCTTCTATGAAagagcatttaaaaattcataacggAGTATATGATCAATATATTACTGAAGAATGTAATTTCAAGACGCCAGAGTTCAAAACTGCAAACATCCGCAAtgaatacatttgtaatgaatgtactTATACCACATTTGTCAAAACTAATCTAAgtagacatttaaaaattcataaaggtgatgaggacaaatataagtgtaaagaatgtgactataaaacaaggCAGAAAACTcgactaaaggaacatgtcaaaattcatactggtgatgaatataagtgtacagaatgtgattataaaacagtatggaaaagtaatctaaaggaacacatcaacgTTCATACAGGTgtcgaatataagtgtaaagggtgtgattataaaacactacgGAAACATCAACTAATgggacatgtcaaaattcatagcggtgatgagtataagtgtaaagaatgtgattataaaacagtatggaaaagtaatctaaaggtacacatcagaattcatacaagtgataaacataagtgtaatgaatgtgattataaaactgtgcaCAAAAATggactaaaggaacatgtcaaaattcatacaggggatgaatataaatgtaaagaatgtgattataaaacagtgcggaaagatCAACTAAAGcgacatgttaaaattcatacaggtgatgaatataagtgtaaagaatgtaattataaaactgtgtggaaaaatagtctaatggaacatgtcaaaattcatagaggtgacaaatataagtgtgaagaatgtgattataaaacggtgtggaaaaataatctaaaggctcatgttaaaattcatgcaggtgttgaatttaagtgtaacgaatgtaattataaaacagggtggaaaaatcaactaaaggaacatgtcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaacagtgcggaaaaattgtttaaaggcacacatcaaaattcatacgggtgacgaatataaatgtaaagaatgtgattataaaacggtatggaaggGTTCTTTAAAGAAACATGTTgcaattcatacaggcgatgaatataagtgtaaagaatgtgattataaaacagtgtggaaatttaatttaaaggaacatgtaaaaattcatgctggtgatgaatatcataagtgtaaagaatgtgattataaaacattgtggaaaagaattctaaaggaacacataaaaattcatacaggtgatgaatataagtgtaaacaatgtgattataaaacagcatttaaaagtaatataaaacaacacatcaaaattcatacaggtaacaaatataagtgtaaagaatgtgactataaaacagtgcacaAAAGTAGTCTAAATGCACACacaaaaattcatacaggtgacgaatataagtgtaaagaatgtgagtataaaacTGTGAGgaaatatcaactaaaggaacatatcaaaattcatacaggtgatgaatataagtgtgaagaatgtgactataaaacagtgcggaaagatcgactaaagcaacatgtcaaaattcacactggcgatgaatataagtgtaaagaatgtgattataaaacagtgtggaaaaattgtttaaaggaacatgtcaaaattcatataggtCACAATGAAAGTGCATGA
Protein Sequence
MDVDSTESCAIKSEMILTETFMFSGYNEDYECREPKTEPAVYEELFKCKEEDSAEYIDIQAASMQSINECNFTTIEKNCLIEHLKITKNDYFSCEECNFTTLLESSMKEHLKIHNGVYDQYITEECNFKTPEFKTANIRNEYICNECTYTTFVKTNLSRHLKIHKGDEDKYKCKECDYKTRQKTRLKEHVKIHTGDEYKCTECDYKTVWKSNLKEHINVHTGVEYKCKGCDYKTLRKHQLMGHVKIHSGDEYKCKECDYKTVWKSNLKVHIRIHTSDKHKCNECDYKTVHKNGLKEHVKIHTGDEYKCKECDYKTVRKDQLKRHVKIHTGDEYKCKECNYKTVWKNSLMEHVKIHRGDKYKCEECDYKTVWKNNLKAHVKIHAGVEFKCNECNYKTGWKNQLKEHVKIHTGDEYKCKECDYKTVRKNCLKAHIKIHTGDEYKCKECDYKTVWKGSLKKHVAIHTGDEYKCKECDYKTVWKFNLKEHVKIHAGDEYHKCKECDYKTLWKRILKEHIKIHTGDEYKCKQCDYKTAFKSNIKQHIKIHTGNKYKCKECDYKTVHKSSLNAHTKIHTGDEYKCKECEYKTVRKYQLKEHIKIHTGDEYKCEECDYKTVRKDRLKQHVKIHTGDEYKCKECDYKTVWKNCLKEHVKIHIGHNESA

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-