Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010002375.1:3520881-3522585[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 15 0.022 0.32 11.7 2.1 1 23 141 163 141 163 0.98

2 15 2.2e-05 0.00032 21.1 1.6 1 23 168 190 168 190 0.98

3 15 0.00022 0.0031 18.0 1.3 1 23 195 217 195 217 0.98

4 15 0.027 0.38 11.4 0.6 1 23 222 244 222 244 0.98

5 15 3.1e-05 0.00044 20.7 3.5 1 23 249 271 249 271 0.99

6 15 0.0075 0.11 13.2 0.8 1 23 276 298 276 298 0.98

7 15 0.00048 0.0068 16.9 1.4 1 23 303 325 303 325 0.98

8 15 5.7e-05 0.00081 19.8 0.9 1 23 330 352 330 352 0.99

9 15 0.00033 0.0047 17.4 1.1 1 23 357 379 357 379 0.98

10 15 0.0059 0.083 13.5 5.0 1 23 384 406 384 406 0.99

11 15 0.00014 0.002 18.6 2.5 1 23 411 433 411 433 0.99

12 15 0.0042 0.059 14.0 0.8 1 23 438 460 438 460 0.96

13 15 0.00032 0.0045 17.5 2.1 1 23 465 487 465 487 0.99

14 15 0.023 0.32 11.7 0.3 1 23 492 514 492 514 0.98

15 15 0.00018 0.0026 18.2 1.3 1 23 519 541 519 541 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	15	0.022	0.32	11.7	2.1	1	23	141	163	141	163	0.98
2	15	2.2e-05	0.00032	21.1	1.6	1	23	168	190	168	190	0.98
3	15	0.00022	0.0031	18.0	1.3	1	23	195	217	195	217	0.98
4	15	0.027	0.38	11.4	0.6	1	23	222	244	222	244	0.98
5	15	3.1e-05	0.00044	20.7	3.5	1	23	249	271	249	271	0.99
6	15	0.0075	0.11	13.2	0.8	1	23	276	298	276	298	0.98
7	15	0.00048	0.0068	16.9	1.4	1	23	303	325	303	325	0.98
8	15	5.7e-05	0.00081	19.8	0.9	1	23	330	352	330	352	0.99
9	15	0.00033	0.0047	17.4	1.1	1	23	357	379	357	379	0.98
10	15	0.0059	0.083	13.5	5.0	1	23	384	406	384	406	0.99
11	15	0.00014	0.002	18.6	2.5	1	23	411	433	411	433	0.99
12	15	0.0042	0.059	14.0	0.8	1	23	438	460	438	460	0.96
13	15	0.00032	0.0045	17.5	2.1	1	23	465	487	465	487	0.99
14	15	0.023	0.32	11.7	0.3	1	23	492	514	492	514	0.98
15	15	0.00018	0.0026	18.2	1.3	1	23	519	541	519	541	0.99

Sequence Information

Coding Sequence: ATGGATATCGACTCGGtagactttattgaaaattgtggtataaaatcagaagtgattttaacagaaacattttctttttgtaagaaATACGAAGATTGTGGGAGTAAGGAACTGAAACCAGAGCCAGATTACGAAGAATCGCTTCAATGTAATGAAGAAAATGATCTAGCAGAACCCATAGATACATGTGCTACTCCGATCCAAACAGATGTTTGTAGCGACtataatattataacaattGGAGAAAATTCCCAAATAGATCTTGTGGAAGCTTCTAACTTTACAAACGAATTAGAATTTTGTATAAAAGAGCATACGAAGATTCACAATGATGGATACaatattgaagaaaataattttaagatgcCAGAAATGTTCTCTTTATCAACGCAGTTGAATATACCTACAAGCGGGAATGAATACAGTTGTAATGAATGTACTTACaccacattaaataaaaattatttaaagagacATGTGAAGATTCACAAAAGTGCTACATATAGTTGtgagaaatgtgattataaaacagcgaggaaaagtaatctaaagcaacatgtcaaaattcatactggtgacgaatataactgtaaagaatgtgattataaaacagtacagaaaagttatctaatgcaacatgtcaaaattcatactggtgacaaatataattgtaaagagtgtgattataaaacggtatggaaaagtcttctaaaggaacatgtcaaaattcatactggtgatgaatataagtgtaaagaatgtgattataaaacagtacataaaagtaatctaatgaaacatgtcaaaattcatactggtgagaaatataagtgtaaagagtgtgattataaaacagtatggaaaagtcttctaaaggaacatgtcaaaattcatactggtgatgaatatatgtgtaaagaatgtgattataaaacagtgaagaaaagttatctaatgcaacatgtcaaaattcatactggtgacgaatataagtgtaaagattgtgattataaaacagtacagaaaagttatctaatagaacatgtcaaaattcatactggtgacaaatatatgtgtaaagagtgtggttataaaacagtacagaaaagatatctaatgcaacatgtcaaaattcatatgggtatagaatataagtgtaaacaatgtaattataaaacagtacagaaaagaTATCTAATGcatcacgtcaaaattcatactggtgacgaatataagtgtaaaaaatgtgattataaaacagtacagaaaagttatctaatgcaacatgtcaaaattcatactgctgacaaatatttgtgtaaagagtgtgattatcaAACAGCACAGAAAAGATatttaatgcaacatgtcaaaattcatacaagtgacgaatataagtgtcaagaatgtaattataaaacagtacagaaaagatatctaatgcaacatatcaaaattcattctggtgacaaatatatatgtaaagagtgtgattataaaacggcatGGAAAAgtcttctaaaggaacatgtcaaaattcatactggtgacgaatataagtgtaaacaatgtgattataaaacggtacagaaaagttatctaatagaacatgtcaaaattcatactggtgacaaatatatatga
Protein Sequence: MDIDSVDFIENCGIKSEVILTETFSFCKKYEDCGSKELKPEPDYEESLQCNEENDLAEPIDTCATPIQTDVCSDYNIITIGENSQIDLVEASNFTNELEFCIKEHTKIHNDGYNIEENNFKMPEMFSLSTQLNIPTSGNEYSCNECTYTTLNKNYLKRHVKIHKSATYSCEKCDYKTARKSNLKQHVKIHTGDEYNCKECDYKTVQKSYLMQHVKIHTGDKYNCKECDYKTVWKSLLKEHVKIHTGDEYKCKECDYKTVHKSNLMKHVKIHTGEKYKCKECDYKTVWKSLLKEHVKIHTGDEYMCKECDYKTVKKSYLMQHVKIHTGDEYKCKDCDYKTVQKSYLIEHVKIHTGDKYMCKECGYKTVQKRYLMQHVKIHMGIEYKCKQCNYKTVQKRYLMHHVKIHTGDEYKCKKCDYKTVQKSYLMQHVKIHTADKYLCKECDYQTAQKRYLMQHVKIHTSDEYKCQECNYKTVQKRYLMQHIKIHSGDKYICKECDYKTAWKSLLKEHVKIHTGDEYKCKQCDYKTVQKSYLIEHVKIHTGDKYI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -