Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010001223.1:5526896-5528761[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 20 0.00027 0.0038 17.7 0.6 1 23 65 87 65 87 0.98

2 20 0.86 12 6.7 2.9 1 23 92 114 92 114 0.97

3 20 2.2e-05 0.00032 21.1 0.5 1 23 119 141 119 141 0.99

4 20 0.00017 0.0025 18.3 1.5 1 23 146 168 146 168 0.99

5 20 0.044 0.62 10.7 1.8 1 23 173 195 173 195 0.99

6 20 0.00029 0.0041 17.6 4.7 1 23 200 222 200 222 0.99

7 20 1.5 21 5.9 3.9 1 23 227 249 227 249 0.98

8 20 0.034 0.49 11.1 0.2 1 23 254 276 254 276 0.98

9 20 0.00034 0.0048 17.4 0.9 1 23 281 303 281 303 0.99

10 20 0.061 0.86 10.3 1.5 1 23 308 330 308 330 0.98

11 20 0.00019 0.0027 18.2 0.9 1 23 335 357 335 357 0.99

12 20 0.72 10 6.9 3.4 1 23 362 384 362 384 0.98

13 20 0.0011 0.015 15.8 0.2 5 23 393 411 392 411 0.96

14 20 0.013 0.18 12.4 1.7 1 23 416 438 416 438 0.99

15 20 8.8e-06 0.00012 22.4 0.9 1 23 443 465 443 465 0.99

16 20 0.17 2.4 8.9 2.9 1 23 470 492 470 492 0.97

17 20 0.046 0.65 10.7 1.0 1 23 497 519 497 519 0.98

18 20 0.00078 0.011 16.3 1.3 1 23 524 546 524 546 0.98

19 20 0.037 0.52 11.0 1.7 1 23 551 573 551 573 0.99

20 20 0.012 0.17 12.5 0.1 1 21 578 598 578 599 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	20	0.00027	0.0038	17.7	0.6	1	23	65	87	65	87	0.98
2	20	0.86	12	6.7	2.9	1	23	92	114	92	114	0.97
3	20	2.2e-05	0.00032	21.1	0.5	1	23	119	141	119	141	0.99
4	20	0.00017	0.0025	18.3	1.5	1	23	146	168	146	168	0.99
5	20	0.044	0.62	10.7	1.8	1	23	173	195	173	195	0.99
6	20	0.00029	0.0041	17.6	4.7	1	23	200	222	200	222	0.99
7	20	1.5	21	5.9	3.9	1	23	227	249	227	249	0.98
8	20	0.034	0.49	11.1	0.2	1	23	254	276	254	276	0.98
9	20	0.00034	0.0048	17.4	0.9	1	23	281	303	281	303	0.99
10	20	0.061	0.86	10.3	1.5	1	23	308	330	308	330	0.98
11	20	0.00019	0.0027	18.2	0.9	1	23	335	357	335	357	0.99
12	20	0.72	10	6.9	3.4	1	23	362	384	362	384	0.98
13	20	0.0011	0.015	15.8	0.2	5	23	393	411	392	411	0.96
14	20	0.013	0.18	12.4	1.7	1	23	416	438	416	438	0.99
15	20	8.8e-06	0.00012	22.4	0.9	1	23	443	465	443	465	0.99
16	20	0.17	2.4	8.9	2.9	1	23	470	492	470	492	0.97
17	20	0.046	0.65	10.7	1.0	1	23	497	519	497	519	0.98
18	20	0.00078	0.011	16.3	1.3	1	23	524	546	524	546	0.98
19	20	0.037	0.52	11.0	1.7	1	23	551	573	551	573	0.99
20	20	0.012	0.17	12.5	0.1	1	21	578	598	578	599	0.96

Sequence Information

Coding Sequence: ATGGGTGTTGAGTGTAATGACAGTTATCCGATAAAATCGGAAATAAAACAGGAAGTGGTTGTAAATGAAACATTCGCCTATAGTGGAAAAAatgaagattatggAAGTGAAGAATTGCCGCCCAATTTTGGCGCAGCTTTTATACAAGAAAGAAATATGGATATGGAGCACATCAATAaatccaaatgtaaatatatttgtaatgaatgtaattataaaacagtgaggaaagatCGACTTAATGAAcacatcagaatccatactggtgatgagcataagtgtaaggaatgtgactacaaaacaccatggagaCAGAGTTTTAAGGAACATATAAAATTGCATACTGGTGATTGCTATAAATGCAATGATTGTGACTTTAGAGCAGTGAGAAAAGATTATCTAAAAGCACACAttagaatccatactggtgatgaatttaaatgtaatgaatgtgactttaaaacagtgaggaaagatAGACTTAACACAcacatcagaatccatactggcgatgaatataagtgtaaggaatgtgactacaaaacaccatggaacaAGAGTCTTAAGCTACATACAAAAATGCATACTGGTGATTgctataaatgtaatgaatgcaactttaaaacagtaacaaaatttcatcttaaaacacacatcagaatccatactggtgatgagcataagtgtaaggaatgtaacttcaaaacaccatggaaacagagttttaaggaacatataaaaatgCATACTGGTGATCgctataaatgtaatgaatgtgcctttcaaacagtgtggaaagatcaacttaaagcacacatcagaatccatactggtgatgaatttaaatgtaatgaatgcgaCTTTAAAACAGTGAAGAAAGATAGACTTAACGCACACATCAGAATCCacacaggcgatgaatataagtgtaaggaatgtgactataaaacaccatggaaccAAAGTTTTAAGCTacatataaaaatgcataatggTGATGgctataaatgtaatgaatgtgattttaaaacggtAAGAAAAGGTCGTCTTAAagcacacatcaaaattcatactggtgacgagcataagtgtaaggaatgtgacttcaaaacaccatggaaacagagttttaaggaacatataaaaatgCATACTGGTGATGACTATAAATggaatgaatgtgattataaaacagtgagaaaagaACAACTTAAAGCACACATTAGAACCCATAGTggcaatgaatataagtgtaaggaatgtgactacaaaacaccatggaagcagaattttaaggaacatataaaaatgCATACTGGTGATGgctataaatgtaatgaatgtaactataaaacggtGAGAAAAGTTCAACTTAAAGCAcacatcagaatccatactggtgatgaatataagtgtaaagagtgtgactaCAAAACAGCATGGAAGCAGAATTTTAAGAATCATGTAAAATTTCATAACAATAATGattataagtgtaaggaatgcgaCTACAAAACACCTTGGAAGCAGAAATTAAAGgttcatgtaaaaattcataccggcgatgagtataaatgtaatgaatgtaattttaaaccaACGAGCAAAAAACAACTTAAAGCGCACATCAGAATTCATACTggcgaggaatataagtgtaaagagtgtgactacaaaacaccatggaaacagagttttaaggaacatataaaaatgCATACTGGTGATGgctataaatgtaatgaatgtaactatGAAACAGTGGAGAAAGATCAAATTAAAGCACACATCAGAATCcagaacatataa
Protein Sequence: MGVECNDSYPIKSEIKQEVVVNETFAYSGKNEDYGSEELPPNFGAAFIQERNMDMEHINKSKCKYICNECNYKTVRKDRLNEHIRIHTGDEHKCKECDYKTPWRQSFKEHIKLHTGDCYKCNDCDFRAVRKDYLKAHIRIHTGDEFKCNECDFKTVRKDRLNTHIRIHTGDEYKCKECDYKTPWNKSLKLHTKMHTGDCYKCNECNFKTVTKFHLKTHIRIHTGDEHKCKECNFKTPWKQSFKEHIKMHTGDRYKCNECAFQTVWKDQLKAHIRIHTGDEFKCNECDFKTVKKDRLNAHIRIHTGDEYKCKECDYKTPWNQSFKLHIKMHNGDGYKCNECDFKTVRKGRLKAHIKIHTGDEHKCKECDFKTPWKQSFKEHIKMHTGDDYKWNECDYKTVRKEQLKAHIRTHSGNEYKCKECDYKTPWKQNFKEHIKMHTGDGYKCNECNYKTVRKVQLKAHIRIHTGDEYKCKECDYKTAWKQNFKNHVKFHNNNDYKCKECDYKTPWKQKLKVHVKIHTGDEYKCNECNFKPTSKKQLKAHIRIHTGEEYKCKECDYKTPWKQSFKEHIKMHTGDGYKCNECNYETVEKDQIKAHIRIQNI

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -