Lyun007343.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Lamprigera yunnana
Gene Symbol
-
Assembly
GCA_013368075.1
Location
JABVZV010001223.1:10904968-10906741[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 17 2.6 36 5.2 6.3 1 23 91 113 91 113 0.97
2 17 0.00012 0.0017 18.8 1.3 1 23 118 140 118 140 0.99
3 17 1.6e-05 0.00022 21.6 0.8 1 23 145 167 145 167 0.99
4 17 0.001 0.015 15.9 1.6 1 23 172 194 172 194 0.99
5 17 6.6e-05 0.00093 19.6 0.9 1 23 199 221 199 221 0.99
6 17 0.0047 0.066 13.8 0.5 1 23 226 248 226 248 0.99
7 17 2.3e-05 0.00033 21.1 1.1 1 23 253 275 253 275 0.99
8 17 0.47 6.6 7.5 2.8 1 23 280 302 280 302 0.98
9 17 7.9e-06 0.00011 22.5 0.5 1 23 307 329 307 329 0.99
10 17 0.00015 0.0021 18.5 1.7 1 23 334 356 334 356 0.99
11 17 3.1e-05 0.00043 20.7 1.5 1 23 361 383 361 383 0.99
12 17 1.3 18 6.2 3.9 1 23 388 410 388 410 0.97
13 17 0.00033 0.0047 17.4 1.4 1 23 415 437 415 437 0.98
14 17 0.24 3.4 8.4 2.7 1 23 442 464 442 464 0.98
15 17 3.6e-06 5.2e-05 23.6 0.8 1 23 469 491 469 491 0.99
16 17 0.39 5.6 7.8 4.1 1 23 496 518 496 518 0.98
17 17 9.2e-05 0.0013 19.2 2.6 1 23 523 545 523 545 0.99

Sequence Information

Coding Sequence
ATGGATGTCgattataatgaaagttatccaataaaatcggaactggttgtaaatgaaacattttcatttagtggAAAATATGAAGattatggGAGTGAAGAAGTGAAAGCGGAGCTGGTAGATTTTGAAGCAGCTTCTAAATGGAAAAGAGATATTCATATACAGCACTCCAATAGATCCAAATgtgaatatatttgtaatgaatctAATTATAAGACACAGCAGAAACAAAATTCTACGActcatgtgaaaattcatagtgatgATAAGtacaagtgtaaggaatgcCACTACAAAACATTATGGAAgcagaatttaaagaaacatataaaaattcatactggcgatgaatataagtgtaatgaatgtgactacaaaacagtacggaaaaatagtctaaaggagcatgtgaaaattcataccagtgatgagtataaatgtaatgaatgtgactataaatcaGTGAGAAAATATGAACTTAAAGCACATGTCAGAATACATATTGGTGataagtataaatgtaatgaatgtgactataaaacagtaaggaAAAATAGGCTAAAGgagcatgtaaaaattcatactggtgacgagtataaatgtaatgaatgtgactataaaacggtgAGTAAAGATAGACTTAAAGCACACATCAGACTccatagtggtgatgaatataaatgtaatgaatgtgactataagaCAGTGTGGAGAGATCTATTTAAAGCAcacatcagaatccatactggcgatgaatataagtgtaaggaatgtgaatttaaaacaataaggAAAGATCAACTGAAAGCACACATCAggatccatactggtgatgaatataaatgtaaagaatgcagCTATATAACACCATGGAAGCAACATTTTAAGGATCATTTGAaagttcatactggtgatgagtataaatgtaatgaatgtgactataaatcaGTGACAAAATATCAACTTATAGCACACATCAGAAtacacactggtgatgaatataaatgtaaggaatgtgactacaaaacagtacggaaaaatagtctaaaggagcatgtgaaaattcatactggtgatgagtataaatgtaatgaatgtgactataaatcaGTGAGAAAATATGAACTTAAAACACATGTCAGAATACATACTGGTGataagtataaatgtaatgaatgtcactataaaacagtatggaaaaataggCTAAAGGAGCATagaaaaattcatactggtgatgagtataaatgtaatgaatgtgactataaaacggtgAGGAAAGATAGACTTAAAGCACATAACagaattcacactggtgatgaatataaatgtaaggaatgtgactttaaaacaatatggaaggGCCATtttaaggaacatgtaaaaatccatactggcgATAAGtacaaatgtaatgaatgtgactttacGACAGCGAGGAAAAGTAATCTTAAAGGGCACAtcagaattcatactggtgatgaatataagtgtaaggaatgtgactttaaaacaccatggaagtgCAATTTTAAGAAACATGTAAATATCCATGGTAGTGataagtataaatgtaatgaatgtgaatTTAAAACAGCTAGAAAAGATCATCTTAAAGGACACATGAGAATCCATActagtgatgaatataagtgtaaggaaggTGGCTACAAAACACCATGGGAGCATAATCTAAAGACATTTGAATATTCATAG
Protein Sequence
MDVDYNESYPIKSELVVNETFSFSGKYEDYGSEEVKAELVDFEAASKWKRDIHIQHSNRSKCEYICNESNYKTQQKQNSTTHVKIHSDDKYKCKECHYKTLWKQNLKKHIKIHTGDEYKCNECDYKTVRKNSLKEHVKIHTSDEYKCNECDYKSVRKYELKAHVRIHIGDKYKCNECDYKTVRKNRLKEHVKIHTGDEYKCNECDYKTVSKDRLKAHIRLHSGDEYKCNECDYKTVWRDLFKAHIRIHTGDEYKCKECEFKTIRKDQLKAHIRIHTGDEYKCKECSYITPWKQHFKDHLKVHTGDEYKCNECDYKSVTKYQLIAHIRIHTGDEYKCKECDYKTVRKNSLKEHVKIHTGDEYKCNECDYKSVRKYELKTHVRIHTGDKYKCNECHYKTVWKNRLKEHRKIHTGDEYKCNECDYKTVRKDRLKAHNRIHTGDEYKCKECDFKTIWKGHFKEHVKIHTGDKYKCNECDFTTARKSNLKGHIRIHTGDEYKCKECDFKTPWKCNFKKHVNIHGSDKYKCNECEFKTARKDHLKGHMRIHTSDEYKCKEGGYKTPWEHNLKTFEYS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-