Basic Information

Insect: Lamprigera yunnana
Gene Symbol: -
Assembly: GCA_013368075.1
Location: JABVZV010001931.1:2597048-2598971[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 19 0.12 1.7 9.4 0.6 1 23 111 133 111 133 0.97

2 19 0.00057 0.0081 16.7 1.1 1 23 138 160 138 160 0.98

3 19 0.2 2.8 8.7 1.1 1 23 165 187 165 187 0.97

4 19 0.015 0.21 12.2 0.9 1 23 192 214 192 214 0.99

5 19 0.2 2.8 8.7 1.1 1 23 219 241 219 241 0.97

6 19 0.00011 0.0016 18.9 0.6 1 23 246 268 246 268 0.99

7 19 0.0025 0.035 14.7 0.3 1 23 273 295 273 295 0.99

8 19 0.0027 0.039 14.5 0.7 1 23 300 322 300 322 0.98

9 19 0.002 0.028 15.0 0.7 1 23 327 349 327 349 0.98

10 19 5.8e-05 0.00083 19.8 1.3 1 23 354 376 354 376 0.98

11 19 0.039 0.56 10.9 2.1 1 23 381 403 381 403 0.98

12 19 0.025 0.35 11.5 1.4 1 23 408 430 408 430 0.97

13 19 0.00085 0.012 16.1 1.0 1 23 435 457 435 457 0.99

14 19 0.0023 0.033 14.8 0.3 1 23 462 484 462 484 0.98

15 19 0.0031 0.044 14.4 0.2 1 23 489 511 489 511 0.98

16 19 0.001 0.014 15.9 1.0 1 23 516 538 516 538 0.99

17 19 0.0021 0.03 14.9 0.5 1 23 543 565 543 565 0.98

18 19 0.0031 0.044 14.4 0.2 1 23 570 592 570 592 0.98

19 19 0.0045 0.063 13.9 1.3 1 23 597 619 597 619 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	19	0.12	1.7	9.4	0.6	1	23	111	133	111	133	0.97
2	19	0.00057	0.0081	16.7	1.1	1	23	138	160	138	160	0.98
3	19	0.2	2.8	8.7	1.1	1	23	165	187	165	187	0.97
4	19	0.015	0.21	12.2	0.9	1	23	192	214	192	214	0.99
5	19	0.2	2.8	8.7	1.1	1	23	219	241	219	241	0.97
6	19	0.00011	0.0016	18.9	0.6	1	23	246	268	246	268	0.99
7	19	0.0025	0.035	14.7	0.3	1	23	273	295	273	295	0.99
8	19	0.0027	0.039	14.5	0.7	1	23	300	322	300	322	0.98
9	19	0.002	0.028	15.0	0.7	1	23	327	349	327	349	0.98
10	19	5.8e-05	0.00083	19.8	1.3	1	23	354	376	354	376	0.98
11	19	0.039	0.56	10.9	2.1	1	23	381	403	381	403	0.98
12	19	0.025	0.35	11.5	1.4	1	23	408	430	408	430	0.97
13	19	0.00085	0.012	16.1	1.0	1	23	435	457	435	457	0.99
14	19	0.0023	0.033	14.8	0.3	1	23	462	484	462	484	0.98
15	19	0.0031	0.044	14.4	0.2	1	23	489	511	489	511	0.98
16	19	0.001	0.014	15.9	1.0	1	23	516	538	516	538	0.99
17	19	0.0021	0.03	14.9	0.5	1	23	543	565	543	565	0.98
18	19	0.0031	0.044	14.4	0.2	1	23	570	592	570	592	0.98
19	19	0.0045	0.063	13.9	1.3	1	23	597	619	597	619	0.99

Sequence Information

Coding Sequence: atggatgttgattctattgaaagttgtgcaataaaatctgaagtgattttaacagaaacattttcgtTTTGTGAACAATACAGTGATTATGGGGATAAAGAACCAAAAACAGAGCCAATAGATTatgaagaatcttttaaatgtaaagaagaaGATATTTCTGTAGAGCAGACAGGCGATCATGCTGTTGCAATGTCACATTTTGACATTGcaacagtgcaaaaaattagtaaaaatgtgcaatatttttgtaaggagcGTAACTTTACAACGCAGTCACAGAACTTCTGTTTAACACCACAGTGGAACACTAAAAAAAGTGGTGACAAATATAtatgtaatgaatgtaactatACTACATTAATCAAAGGCTATCTAAgaagacatgttaaaattcataaaggggctaaatataggtgtaaagaatgtgactattacacagtgcgaaaaaatgatctaaaagaacatgtcaaaattcatacatgtgatgaatataagtgtaaagaatgtgattataaaacggtatggcaAAGAAGgctaaaagaacatgtcaaaattcatacaggtgttgaatataagtgtaaagagtgtgcttataaaacaccatggcaaagtagtctaaagcaacatatcaaaatgcatacaggcgatgaatataaatgtaaagaatgtgattataaaacagtgtggcaaagaaggctaaaggaacatgtcaaaattcatacaggtgatgaatataagtgtgaagaatgtgattaccaAACGGTGCGAAAAGATTCcctaaaagaacatgtcaaaattcatacaggtgcagagtataaatgtaaagagtgtggttataaaacagcatgggaaagtagtctaaaggaacatatcaaaattcatacaggtaataaatatgagtgtaaagaatgtgattataaaacagtgtggcaaagtagtctaaaaaaacatgtcaaaattcatacaggtaataaatatgagtgtaaagaatgtgattataaaacagtatggcaaagtagtctaaagcgacatgtcaaaattcatacaggtgacaaatatgagtgtaaagaatgtgattataaaacagtgcgaaaaaatgatctaaagaaacacgtcaaaattcatacaggtgatgaatataagtgtaaagaatgtgattataaaacagtgtggcaaagtaggctaaagaaacatgtcaaaaatcATACAGTcgacaaatatgagtgtaaagaatgtgattataaaacattgcgaaaaaattatctaaaggaacatgtcaaaattcatacaggtgataaatataggtgtaaagaatgtaattatagaACACCATGGCAAAGTAATCTAAggcaacatattaaaattcatacaggtgacaaatttgagtgtaaagaatgtgattataaaacagcatggccaagtagtctaaagcaacatattaaaattcatacaggcgacacatatgagtgtaaagaatgtgagtaTATAACAACAtggcaaagtaatctaaaggcacatgtcaaaattcatacaggtgataaatataggtgtaaagaatgtaattataaaacaccatggcaaagtaatctaaggcaacatattaaaattcatacaagtgacAAAtttgagtgtaaagaatgtgattataaaacagcatggcaaagtagtctaaagcaacatattaaaattcatacaggcgacacatatgagtgtaaagaatgtgagtaTATAACAACAtggcaaagtaatctaaaggcacatgtcaaaattcatacaggtgacaattatgagtgtaaagaatgtgattataaaacagtgtggcaaaatTCCCTaaagaaacatattaaaagaCACAGGTGA
Protein Sequence: MDVDSIESCAIKSEVILTETFSFCEQYSDYGDKEPKTEPIDYEESFKCKEEDISVEQTGDHAVAMSHFDIATVQKISKNVQYFCKERNFTTQSQNFCLTPQWNTKKSGDKYICNECNYTTLIKGYLRRHVKIHKGAKYRCKECDYYTVRKNDLKEHVKIHTCDEYKCKECDYKTVWQRRLKEHVKIHTGVEYKCKECAYKTPWQSSLKQHIKMHTGDEYKCKECDYKTVWQRRLKEHVKIHTGDEYKCEECDYQTVRKDSLKEHVKIHTGAEYKCKECGYKTAWESSLKEHIKIHTGNKYECKECDYKTVWQSSLKKHVKIHTGNKYECKECDYKTVWQSSLKRHVKIHTGDKYECKECDYKTVRKNDLKKHVKIHTGDEYKCKECDYKTVWQSRLKKHVKNHTVDKYECKECDYKTLRKNYLKEHVKIHTGDKYRCKECNYRTPWQSNLRQHIKIHTGDKFECKECDYKTAWPSSLKQHIKIHTGDTYECKECEYITTWQSNLKAHVKIHTGDKYRCKECNYKTPWQSNLRQHIKIHTSDKFECKECDYKTAWQSSLKQHIKIHTGDTYECKECEYITTWQSNLKAHVKIHTGDNYECKECDYKTVWQNSLKKHIKRHR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -